SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031919 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000031919
Domain Number 1 Region: 319-496
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00000112
Further Details:      
 
Domain Number 2 Region: 2-211
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.47e-48
Family BAR domain 0.0069
Further Details:      
 
Domain Number 3 Region: 185-292
Classification Level Classification E-value
Superfamily PH domain-like 4.59e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 740-795
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000617
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031919   Gene: ENSDNOG00000030629   Transcript: ENSDNOT00000052602
Sequence length 796
Comment pep:known_by_projection scaffold:Dasnov3.0:JH583474.1:311294:519404:1 gene:ENSDNOG00000030629 transcript:ENSDNOT00000052602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQKFSQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERRRLDGKKKFDKES
EKYYSILDKHLNLSAKKKESHLQEADSQIDREHQNFYEASLEYVFKIQEVQEKKKFEFVE
PLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFESTRQEVERLMQRMKSANQ
DYRPPSQWTMEGYLYVQERRPLGFTWTKHYCTYDKGSKTFTMSVSEMKSSGKMNGLVTSS
PEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEANRKLWLEAMDGKEPIYTL
PAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGGVNSKVQKLMSTTFSPKSP
PDVDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIVAVKSDDQNYRVEAVHALVH
RLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMRAQEETVAAMMNIKFQN
IVVEILIEHYEKIFHTAPDPNVPLPQPQPRSGCRRTRAICLSTGSRKPRGRYTPCLAEPD
SDSYSSSPDSTPVGSVESLSSHSSEQNSTSKCASGPTRDKAGGLPWIAAPSPPNGQKSLG
LWTPSPESSSREDAARTDAESDGQSAASAAGPGDVSPPIDLVKRGPYGLAGLKRPSASSL
RSIPAAEGNRSYSGSTQSLASIGSKELPHTPPNPDLPPKTCRRFKLDAASSNGYQRPGSI
VAAKAQLFENVGSVKPVSSGRQAKAMYSCKAEHSHELSFPQGALFSNVYPSVEPGWLKAT
YEGKTGLVPENYVVFL
Download sequence
Identical sequences ENSDNOP00000031919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]