SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032001 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000032001
Domain Number 1 Region: 292-403
Classification Level Classification E-value
Superfamily PH domain-like 4.35e-30
Family Pleckstrin-homology domain (PH domain) 0.000098
Further Details:      
 
Domain Number 2 Region: 473-579
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-24
Family SH2 domain 0.0000142
Further Details:      
 
Domain Number 3 Region: 53-109
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.07e-17
Family Adapter protein APS, dimerisation domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032001   Gene: ENSDNOG00000034851   Transcript: ENSDNOT00000035092
Sequence length 610
Comment pep:novel scaffold:Dasnov3.0:JH572474.1:6581772:6583601:-1 gene:ENSDNOG00000034851 transcript:ENSDNOT00000035092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAWAMAPLAPSVPAAPPGSASPWQPPPSDPWQAAACAAPSNLFLDPYSSPAKHKFCESHA
RAAALDFARRLRLYLASHPQYVGPGAEAAFSRHFAELFLQHFEAEMARASGSLSPPVLAP
LSPGAEIPPHDLSLESCRVGGPLAVLGPSRPSEDLASPLPSSVSSSSTTSSKPKLKKRFS
LHSVGRSVRSSVRGLLQWQGTVDPPSPAGPLETSSGPPVLGGNSNSKSSGGAGTIGRGLI
GDETSPGERWTHRFERLRLSQRGRALKDGTGMVQREELLSFMGAEEAAPDPAGVSRRGGA
TGPTSGGGGQPQWQKCRLLLRSEGRGGGGGSRLEFFVPPKASRPRLSIPCSTITDVRMTT
ALEMPDQENTFVVKVEGPSEYILETADALHVKAWVSNIQKCLSASIAASHFDSMELLPPE
LPPRIPIKEGPPAETVHPLSAPYPPLDTPETATGSFLFQGESEGGEGDQPLSGYPWFHGM
LSRLKAAQLVLAGGTGSHGVFLVRQSETRQGKYVLTFNFQGKAKHLCLSLNEEGQCRVQH
LWFQSIFDMLEHFRVHPIPLESGGSSDVVLVNYVVSSQWQQGEQSRSAGEEVPVHPGSEA
ESRPRALQRC
Download sequence
Identical sequences ENSDNOP00000032001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]