SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032040 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000032040
Domain Number - Region: 32-116
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00378
Family Virus ectodomain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032040   Gene: ENSDNOG00000046477   Transcript: ENSDNOT00000043555
Sequence length 252
Comment pep:novel scaffold:Dasnov3.0:JH581461.1:503071:504621:1 gene:ENSDNOG00000046477 transcript:ENSDNOT00000043555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLPLVSDNETFQCNSSQCSLTNCWNSTSHTFALIVRIPSLIWVPINASDWDGPTAVVTH
KSFREKRAVGTIITLITTIITSISAAATSIVSLVQTGANAQAVNQLAECTASAMQTQNFL
NNHTHGRLLNLQQQVDLLEEEVQQLIQLLRIPCDTKFPHICVMPVTVTNLTKTRLELKKQ
LLGNWNNEFLNFTTQLTHSIIAINNTQAIALNVTLFTDVLNKLHSFFSLPKLVTFAIIGS
AFIISVLCLRWV
Download sequence
Identical sequences ENSDNOP00000032040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]