SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032469 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000032469
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0107
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032469   Gene: ENSDNOG00000034299   Transcript: ENSDNOT00000038037
Sequence length 128
Comment pep:known_by_projection scaffold:Dasnov3.0:JH580384.1:3194946:3204508:1 gene:ENSDNOG00000034299 transcript:ENSDNOT00000038037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRLCCGESWSCPPHVRRKKKTGSQARQPPKQQPPPPQQQNGTKGPETPGHTYEQVLEH
PKSQDRRSPGLWPEESNLYYADIQVCSRTQPRSVRGMKHLRSENTTEYATLRFPRATPHY
DSKNGTLV
Download sequence
Identical sequences ENSDNOP00000032469 XP_004481206.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]