SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032506 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000032506
Domain Number 1 Region: 836-1111
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000494
Family Rhodopsin-like 0.04
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000032506
Domain Number - Region: 470-529
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000759
Family Hormone receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032506   Gene: ENSDNOG00000013629   Transcript: ENSDNOT00000040916
Sequence length 1453
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564821.1:107159:193578:1 gene:ENSDNOG00000013629 transcript:ENSDNOT00000040916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTLIGCGHRQLRYESYYLKMPSYEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYIFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRT
DTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKS
GEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISLMLNLGKYILV
YQVSSILWEIIFESKLIKWNFQIIGLLQIFKNQYIDKSQETDKSPVTFIYLRILNRTLYQ
HSIWHINAEYIKAEEYLGRKNNLWHNWNEFILKTKARVKPKLPSLRVPTTAVTITSSAEL
FQTTVSTTSTTSQKGPMSTTVAGSQEGNKGTKPPPAVSTTKIPPVTNIFPLPERFCEALE
ARGIWWPQTQRGMMVERPCPKGTRGTASYLCVVSTGTWNPKGPDLSNCTSHWVNQLAQKI
RSGENAASLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYN
KAIVDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTD
NIVLEVAVLSTEGQVQDFKFPLGIKGSGSSIQLSANTVKQNSRNGLAKLVFIIYRSLGQF
LSTENATIKLGGDFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDPDNYFNA
NCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKDGVHELL
LTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGIDKTKY
MIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVG
VSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHSNTLKPD
SSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFIFIFHCA
LQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRK
QSESSFISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPVFN
SPGHSLNNARDTSAMDTLPLNGNFNNSYSLRKGDYSESVQVVDCGLSLNDTAFEKMIISE
LVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASSLMHGDNPGLELHHKELEAP
LIPQRTHSLLYQPQKKVKPEGTDSYVSQLTAETEDHLQSPNRDSLYTSMPNLRDSPFQES
SPDVEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMCYQISRGNSDGYIIPINKEGCIPEG
DVREGQMQLVTSL
Download sequence
Identical sequences ENSDNOP00000032506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]