SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000032901 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000032901
Domain Number 1 Region: 313-436
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000129
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000032901
Domain Number - Region: 39-91
Classification Level Classification E-value
Superfamily HR1 repeat 0.00243
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000032901   Gene: ENSDNOG00000036268   Transcript: ENSDNOT00000034828
Sequence length 564
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569176.1:580297:597660:1 gene:ENSDNOG00000036268 transcript:ENSDNOT00000034828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDPPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTARRPSDSRQQAERSPCRGR
VCVSDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIEDTEMVLVDRTLTDISFQNSV
LFTEAGPDFELRLELYGACVEEEGALAGAPKRLATKLSSSLGRSSGRRVRASLDSAGASG
SSPILLPTPAVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASLEENPAWLPLYGSVCCRL
AAQPLCMTQPSASGTLRVQQARELPSWARVHGVLRGTGLFCYGRPEDADAGTEPLFTIAI
NKETRVRAGERDQAPGRPFTLSISNRYGDDEVTHTLQTESRGALQSWMEALWQLFFDMSQ
WKQCCDEIMKIEIPAPRKPPQALAKQRSLYHEMAIEPLDDIAAVTDILAQREGLRLETPP
PWLAMFTDQPALPGPCLPASVAPAPARPQPLPWGRPRTFSLDAIPPDHSPGAACSVAPLP
PQRSPRPKGLCGKGLPRTWLQSPV
Download sequence
Identical sequences XP_004464416.1.11602 ENSDNOP00000032901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]