SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000033046 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000033046
Domain Number 1 Region: 1249-1391
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-49
Family Phosphotyrosine-binding domain (PTB) 0.000000128
Further Details:      
 
Domain Number 2 Region: 280-408
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.5e-35
Family PLC-like (P variant) 0.0051
Further Details:      
 
Domain Number 3 Region: 112-278
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.35e-24
Family Dual specificity phosphatase-like 0.00024
Further Details:      
 
Domain Number 4 Region: 1117-1244
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-23
Family SH2 domain 0.002
Further Details:      
 
Domain Number 5 Region: 12-63
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000033046   Gene: ENSDNOG00000034981   Transcript: ENSDNOT00000048972
Sequence length 1393
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569826.1:75504:86843:1 gene:ENSDNOG00000034981 transcript:ENSDNOT00000048972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSLYPESRKAEPHSFREKVFRKKPPVCAVCKVTIDGTGVSCRVCKVATHRKCEAKVTS
FCQALPPAELRRNTAPVRRIEHLGSTKSLNHSKQRSTLPRSFSLDPLMERRWDLDLTYVT
ERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSEKRHDLSRLNPKVQDFGW
PELHAPLLDKLCSICKAMETWLSADPQHVVVLYCKGSKGKLGVIVSAYMHYSKISAGADQ
ALATLTMHKFCEDKVAAELQPSQRRYISYFSGLLSGSIRMNSSPLFLHYVLVPVLPAFEP
GTGFQPFLKIYQSMQLVYTSGVYHIAGPGPHQQLCISLEPALLLKGDVMVTCYHKSGRGT
DRTLVFRVQFHTCTIHGTRLSFPKDQLDKAWTDERFPFQASVEFVFSSSPEKVKGSTPRN
DPSVSVDYNTAEPAVRWDSYENFNQHHEDSVDGSLTHTRGPLDGSPYAQVQRVPRQTPPA
PSPEPPPPPMLSVSSDSGHSSTLTTEPTAESPGRPPPTVAERQELDRLLGGCGVVSGSRG
AGRETAILDDDEQAPTGRGPHLGLYSGPRPGLGRHCSCRQGYREPSGASNGGYYRPEGTL
ERRRLAYAGYEGPPQGYAEASMEKRRLCRSLSEGPYPYQPELGKPASGDFGYRSPGYREV
VILEDPGLPALCSCPACEEKLALPTAALYGLRLEREAGEGWVSEAGKPLLHPVRPGHPLP
VLVPACGHHHAPVPDYSCLKPPKVGEEGHEGCPYALCPEGRYGHPGYPALVTYGYGGAVP
AYCPAYGRVPRSCGSPGEGRGYPSPGAHSPRAGSISPGSPPYPQSRKLSYEIPAEEGGDR
YPLPGHLAPASPLASAESPEPGSWREDPSGHSAPPLSPRDAQCSASSELSGPSTPLHTSS
PVQGKEGARRQDTRSPTLAPIQRLSPGKTSPPASQGGTQKATELPARSGPEPPTPSSFSP
TSPPHSPNDWPQEKSPGGCSDITNPRSPVPTTLPGLRHAPWQSPRGPPDSPDGSPLTPVP
TQMPWLVASPEPPQSSPTPAFPVAVSYDTNGLTQPPLPEKRHLPGPGQQPGPWGPEQASP
PARGTSHHVTFAPLLPDNAPQPSVPPSQESQSNVKFVQDTSKFWYKPHLSRDQAIALLKD
QEPGAFLIRDSHSFQGAYGLALKVATPPPSTQPWKGDPLEQLVRHFLIETGPKGVKIKGC
PSEPYFGSLSSLVSQHSISPISLPCCLRIPSKDPLEETPEAPAPTNMSTAADLLRQGAAC
SVLYLTSVETESLTGPQAVARASSAALNCSPRPTPGVIHFKVSAHGITLTDNQRKLFFRR
HYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLFAELDPDQPAGAI
VTFITKVLLGQRK
Download sequence
Identical sequences ENSDNOP00000033046 XP_012384050.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]