SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000033659 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000033659
Domain Number 1 Region: 280-319
Classification Level Classification E-value
Superfamily Leucine zipper domain 4.11e-17
Family Leucine zipper domain 0.00025
Further Details:      
 
Domain Number 2 Region: 247-282
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 0.000000602
Family A DNA-binding domain in eukaryotic transcription factors 0.006
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000033659
Domain Number - Region: 196-265
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0366
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000033659   Gene: ENSDNOG00000046358   Transcript: ENSDNOT00000040333
Sequence length 336
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570383.1:222024:223034:-1 gene:ENSDNOG00000046358 transcript:ENSDNOT00000040333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQTMTLNLADPLGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGSSGSGGFSANLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAGGLSFPAQPQQQQPQPQPQPPHHLPQQIPVPHPRLQALKEEPQTVPEM
PGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELA
STANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Download sequence
Identical sequences XP_004470728.1.11602 ENSDNOP00000033659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]