SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000033885 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000033885
Domain Number 1 Region: 149-246
Classification Level Classification E-value
Superfamily TNF-like 2.1e-28
Family TNF-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000033885   Gene: ENSDNOG00000037691   Transcript: ENSDNOT00000049669
Sequence length 246
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569702.1:763314:789988:1 gene:ENSDNOG00000037691 transcript:ENSDNOT00000049669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPWVLLACALPCAADPLLGAFAHRDLQKGSPQLVCSLPGPQGPPGPPGAPGPSGMVGRM
GFPGRDGPDGPDGDRGDSGEEGAPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVSGAPGKH
GTPGKKGPKGKKGEPGLPGPCSCGSGRAKSAFSVAVTKSYPRERLPIKFDKILMNEGGHY
NASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILA
LKQGDE
Download sequence
Identical sequences ENSDNOP00000033885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]