SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000034108 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000034108
Domain Number 1 Region: 42-274
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.97e-69
Family BAR domain 0.00042
Further Details:      
 
Domain Number 2 Region: 267-298,329-386
Classification Level Classification E-value
Superfamily SH3-domain 4.32e-17
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000034108   Gene: ENSDNOG00000039119   Transcript: ENSDNOT00000036794
Sequence length 387
Comment pep:known_by_projection scaffold:Dasnov3.0:JH580140.1:1738144:1773528:1 gene:ENSDNOG00000039119 transcript:ENSDNOT00000036794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWPPRLHLPARSAGGPARLPPRMNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTEL
DAHLENLLSKAECTKMWTEKIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLG
QYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTI
AKERKLLQNKRLDLDAAKTRLKKAKAAETRASSEQELRITQSEFDRQAEITRLLLEGISS
THAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLCNNNQTSVTSLPSASSNV
IGSSAMASTSGLVITSPSNPHDLKECSGSRKARVLYDYDAANSSELSLLADEVITVFSVV
GMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences ENSDNOP00000034108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]