SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000034184 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000034184
Domain Number 1 Region: 24-194
Classification Level Classification E-value
Superfamily MIR domain 1.44e-58
Family MIR domain 0.00000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000034184   Gene: ENSDNOG00000039044   Transcript: ENSDNOT00000036028
Sequence length 211
Comment pep:known_by_projection scaffold:Dasnov3.0:JH563368.1:199127:210879:1 gene:ENSDNOG00000039044 transcript:ENSDNOT00000036028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVTLLFFGGLWGAVGASNLAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGV
TSVDDSNSYWRIRGKTATVCERGTPVKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSA
FGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMA
QPSQNNYWKAMEGIFMKPSEWLKTDTRHAEL
Download sequence
Identical sequences XP_004449986.1.11602 ENSDNOP00000034184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]