SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000034260 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000034260
Domain Number 1 Region: 273-341
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.06e-21
Family Leucine zipper domain 0.0000427
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000034260
Domain Number - Region: 180-237
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00262
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000034260   Gene: ENSDNOG00000041488   Transcript: ENSDNOT00000047995
Sequence length 353
Comment pep:known_by_projection scaffold:Dasnov3.0:JH573338.1:111581:112642:-1 gene:ENSDNOG00000041488 transcript:ENSDNOT00000047995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPGSAAFGFPRGAGTAQPPAPSAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPLGGGGDYDYPGAPAGPGSAVMPG
GAHGTPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPHPHPHPPSAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGS
AGLPGPGGALKGLAAAHPDLRGGVGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQ
RNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
Download sequence
Identical sequences ENSDNOP00000034260 XP_004474466.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]