SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000034854 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000034854
Domain Number - Region: 96-127
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000034854   Gene: ENSDNOG00000049634   Transcript: ENSDNOT00000040427
Sequence length 157
Comment pep:novel scaffold:Dasnov3.0:JH571260.1:3122969:3123594:-1 gene:ENSDNOG00000049634 transcript:ENSDNOT00000040427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRSWSQASRMSPVAGWAPQRRAAPRPAPAAQACSSPSSALGSLAAVPREPGPMAQMAT
TAAGWLWLCCRAHTGPCCHWDFSGGRNAEPSRHDLTYQEPQQQQQQQQQQQQQQQQQFGP
CHEMKQFLGCAQNQGDLKLCEGFSEVLKQCRFANVIA
Download sequence
Identical sequences ENSDNOP00000034854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]