SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000035005 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000035005
Domain Number 1 Region: 99-258
Classification Level Classification E-value
Superfamily SET domain 1.83e-50
Family Histone lysine methyltransferases 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000035005   Gene: ENSDNOG00000038837   Transcript: ENSDNOT00000050943
Sequence length 258
Comment pep:known_by_projection scaffold:Dasnov3.0:JH575209.1:1110403:1126156:-1 gene:ENSDNOG00000038837 transcript:ENSDNOT00000050943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGCA
RSEPKMSTHVKRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNV
YLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDH
VIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDD
QHKIPCHCGAVNCRKWMN
Download sequence
Identical sequences ENSDNOP00000035005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]