SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000000317 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000000317
Domain Number 1 Region: 347-693
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.8e-41
Family Hect, E3 ligase catalytic domain 0.0081
Further Details:      
 
Domain Number 2 Region: 212-293
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.91e-27
Family PHD domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000000317
Domain Number - Region: 142-201
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00417
Family PHD domain 0.023
Further Details:      
 
Domain Number - Region: 70-108
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0182
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000000317   Gene: ENSDNOG00000000419   Transcript: ENSDNOT00000000421
Sequence length 709
Comment pep:novel scaffold:Dasnov3.0:JH577058.1:97840:136456:1 gene:ENSDNOG00000000419 transcript:ENSDNOT00000000421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKMNESKSGDTQNLVCVFCRKNDDCPNKYGERKTNEKWNLTVHYYCLLMSSGIWQRGKEE
EGVYGFLIEDIRKEVNRASKLKCCVCKKTGASIGCVAPRCKRSYHFPCGLQRECIFQFTG
NFASFCWNHRPVQIITSNSYRESLPCTICLEFIEPIPTYSILRSPCCKNAWFHRDCLQIQ
AINAGMFFFRCTVCNNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLHHHERCDVRRC
RCKEGREYNAPDSKWEIKRCQCCGSSGTHLACSSLQSWEQNWECLECRGIIYNSGDFKKA
KKHTLPTSNNVGITDCLLEESSPKLLRQSPGAQSKDLMRQGSKFRRDISTILIELGFQIK
KKTKRLYINKANIWNSALDGFRNQNFNPAYSIEVAYVNENDSFGREHPGSKQEFLSLLMQ
HLESSSLFEGSLSKNLSLNAQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYG
PENTQPILDDVSDFDVAQIIIRINTTTNMADLNSAINECSNYLELIGCLRLITSLSDKYM
LAKDILFYHVIKRVQAPFESFKQGLKTLGVLEKIQTSPEAFCSVLCHKPENLSAKTLSDL
FTVHPLSNVQTLGFWNSYLKAIEDDQSATTMEDILIFVTGCSSIPPTGFKPIPSIECLHM
DFPIGNKCSNCLALPITNTYKEFQENMDFAIRNTLRLEKEESSSHYAGH
Download sequence
Identical sequences ENSDNOP00000000317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]