SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000000692 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000000692
Domain Number 1 Region: 48-162
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 9.55e-52
Family N-terminal domain of cbl (N-cbl) 0.000000559
Further Details:      
 
Domain Number 2 Region: 249-335
Classification Level Classification E-value
Superfamily SH2 domain 2.49e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 341-419
Classification Level Classification E-value
Superfamily RING/U-box 7.69e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 163-248
Classification Level Classification E-value
Superfamily EF-hand 7.48e-38
Family EF-hand modules in multidomain proteins 0.00000519
Further Details:      
 
Domain Number 5 Region: 850-888
Classification Level Classification E-value
Superfamily UBA-like 0.00000618
Family UBA domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000000692   Gene: ENSDNOG00000000905   Transcript: ENSDNOT00000000905
Sequence length 901
Comment pep:known_by_projection scaffold:Dasnov3.0:JH566902.1:164479:232512:-1 gene:ENSDNOG00000000905 transcript:ENSDNOT00000000905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAVGLWIISYILLTFFIFLQKSIYFSFYFKKEIVLKILQIIVLLFHLLQVVRLCQNPKL
ALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKE
GKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFG
EKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLL
RNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNIL
QTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMG
STFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD
PRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPPSPFSMAPQASLPP
VPPRLDLLQQRVSIPSNASGSGTASKAASGSLHKDKPLPIPPTLRDLPPPPPPDRPYCVG
AETRPQRRPLPCTPSDCPSRDKLPPVPSSRLGESWLPRPIPKVPVVASSPSDHWTGRELT
NRHSLPFSLPSQLEPRTDVPRLGGTFSLDTSMNVNSSNPLAGPECEHPKIKPSSSANAIY
SLASRPLPVPKLPPGEQCENEEDTEYMTPSSRPLGLQKPEPKRPLESAQSSRACDCDQQI
DSCTYEAMYNIQSQTSSVAESSTFGEGNLAAAHANTVPEESENEDDGYDVPKPPVPVVLA
RRTLSDISNASSSLAWLSLDGDPTNFTEGSQVPERPPKPFPRRINSERKAGSCQQGGGAA
TTPAATTTSPQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVA
T
Download sequence
Identical sequences ENSDNOP00000000692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]