SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001290 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001290
Domain Number 1 Region: 343-497
Classification Level Classification E-value
Superfamily ARM repeat 5.18e-38
Family MIF4G domain-like 0.0071
Further Details:      
 
Domain Number 2 Region: 60-69
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000251
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001290   Gene: ENSDNOG00000001663   Transcript: ENSDNOT00000001663
Sequence length 507
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569938.1:1317487:1373286:1 gene:ENSDNOG00000001663 transcript:ENSDNOT00000001663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWVVPSAPLSQHFLRIPESGTTRAGGGLGGRGGARGGAPPGSVCRCQCVCPSLLHCLP
PPPPPPPPPEPLQPSASRVVATSSDRNFMNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRD
TLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTK
MTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLA
MLSGILLGNGTLPATILTSLFTDNLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANI
DKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPI
KEMVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVF
SSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKS
VFLDQMKKFVEWLQNAEEESESEGEEN
Download sequence
Identical sequences ENSDNOP00000001290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]