SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001593 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001593
Domain Number 1 Region: 31-149
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.27e-26
Family Hormone receptor domain 0.00058
Further Details:      
 
Domain Number 2 Region: 136-413
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000641
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001593   Gene: ENSDNOG00000002057   Transcript: ENSDNOT00000002057
Sequence length 453
Comment pep:known_by_projection scaffold:Dasnov3.0:JH562576.1:8463:38104:1 gene:ENSDNOG00000002057 transcript:ENSDNOT00000002057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTMRPPRARWLCVLAGALACALGPAGGQATGPLQEGCSYLKEIEAEHQKCLKEEDPENET
TGCGKMWDNLTCWPATPRGQVVVRVCPSIFKLFSSSEGRNVSRSCTDQGWTALEPGPYPV
ACDWNNKTSALPPRQAFYSSVKAGYTVGYGLSLAALLVAMAILSLCRRLRCTRNYIHMHL
FASFVLRAAAVFLKDLALFHSSEDNHCDKGSASCKAAVVLFQYCVMANFFWLLVEGLYLY
TLLSVSFSERKYFWGYILIGWGVPSTFIVVWTIVKSHFEDIECWDTIKSPIWWIIKGPVL
ASILMNFVLFICIIRILAQKLRPPDVRTSDSSPHSRLAKSTLLLIPLFGAHYIMFAFFPE
NFGREAKLAFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRHWRPQGAPGSHAKYQHPR
GSCSAVSTQVSMLTHASPGARRSSSFQAEASLV
Download sequence
Identical sequences ENSDNOP00000001593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]