SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001835 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001835
Domain Number 1 Region: 1278-1357
Classification Level Classification E-value
Superfamily Immunoglobulin 4.68e-18
Family I set domains 0.009
Further Details:      
 
Domain Number 2 Region: 894-968
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000714
Family I set domains 0.044
Further Details:      
 
Domain Number 3 Region: 677-730
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 389-449
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000693
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 5 Region: 541-595
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 444-504
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 7 Region: 1176-1255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000024
Family I set domains 0.048
Further Details:      
 
Domain Number 8 Region: 45-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 733-790
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000863
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 1448-1515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000123
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 11 Region: 785-851
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 1577-1632
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000719
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 13 Region: 311-371
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 618-674
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 
Domain Number 15 Region: 1397-1454
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000196
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001835   Gene: ENSDNOG00000002361   Transcript: ENSDNOT00000002364
Sequence length 1668
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570731.1:3068225:3325466:1 gene:ENSDNOG00000002361 transcript:ENSDNOT00000002364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFFFKYSHSRAKHFLRPFGHFEYLTIRLWKDWTSRNTRSDEDKDGNWDAWGDWSDCSRT
CGGGASYSLRRCLTGRNCEGQNIRYKTCSNNDCPADAEDFRAQQCSAYNDVQYQGRYYEW
LPRYNDPAAPCALKCHARGQNLVVELAPKVLDGTRCNAHSLDMCISGICQAVGCDRQLGS
NAEEDNCGVCAGDGATCRLVRGQSKSQVSPEKREENAIAVPLGSRSVRITVKGPAHLFIE
SKTLQGSKGEHSFSSPGVFVIENTTVEFQKGSERQTFKIPGPLTADFIFKTRYTVAKDSV
VQFFFYQPISHQWRQTDFFPCTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPK
PKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESM
HGEILQVEEWKCMYAPKPKVLQTCNLFDCPKWVAMEWSQCTVTCGQGLRYRVVLCINHRG
QHVGGCNPQLKLHIKEECIIPIPCYKPKEKGPVEAKLPWLKQAQELEETRIATEEPTFIP
EPWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPRPPAQRPCLLGACDQGPA
ARPPDAALQGKDSEATYDWEYAGFTPCTATCLGGHQEAIAVCLHIQTQQTVNDTLCDVVH
RPPAMSQACNTEPCPPRWHMGSWGPCSATCGVGIQTRDVYCLHPGEAPASPEECGDGKPH
ALQACNQFDCPPGWHIEEWQQCSRTCGGGAQKRRVTCRQLLTDGSFVSLSDELCQGPKAS
SHKSCARTDCPPHFTAGDWSKCSVSCGVGIQRRKQVCQRLTAKGRRVPLSEAMCRGQPGL
PLVRSCQMPVCKKIKPEVKTKPGEQGPQILSVQRVYIQTREEKRVNLTIGSRAYLLPNTS
VMIKCPVRRFQKSLIQWEKDGRCLQNSKRLGVTKSGSLKIHSLAAPDIGVYRCVAGSAHE
TVVLKLIGTDNRLIAPPALREHMRGHAGTDRNEAGGLGAAWDKMRPMRSSKNELYLDEGQ
VNKQPFLRALLSHCSSSAGKTSSWEFKNKQFEAAVKQGSYSMDTAQFEDLIKNMSQLMET
GEVSDDLASQVIYQLVAELAKAQPAHVQWRGIPEEAPPAAQLRGETGSVPQGSNAGSSGK
LMFRPQGPVLARQSHPPSISFNKTITSRIGNTVYITKRTKVINILCDLVNPSEVMYTWTK
DGALLKPSVKIILDGIGKMQILNPTRKEQGTYGCLVANHLGSDVESSSVLYAEAPVILSI
ERNITKPEHGQLSVVVGGTVEAALQANVTIRCPVKGVPGPNITWLKRGGSLSDNISLLFN
GSLLLQNVSLENEGTYVCIATNALGKAVATSVLHVLERRLRDNKIVFPKGHKKLIVLESN
TGTNSSDPAGESLPREPLWEPGNWTRCSATCGHSGARIQRPRCAMADGQEVSQALCGHLR
RPPAGFQPCSIRDCPARWVTGAWSACSVSCGEGVRSRQVTCRWTRANGTVQVASPRACAP
KDRPAGTKPCSSHPCDQRVSEPESQCPGRCVRHAGRVQQHQGLCQHPNSSEAPDSHCDGR
RRPALRRNCSSGACDVCWHPGPWRPCPAACGRGFQTRKVHCVHRRSCGSVAERHCMQKTK
PPAWRHCLGPACERNCTDTTHYCMFVKHLNLCSVGLYKQRCCLSCQEG
Download sequence
Identical sequences ENSDNOP00000001835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]