SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001918 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001918
Domain Number 1 Region: 266-411
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.67e-16
Family Retroviral integrase, catalytic domain 0.0095
Further Details:      
 
Domain Number 2 Region: 42-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000131
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001918   Gene: ENSDNOG00000002469   Transcript: ENSDNOT00000002468
Sequence length 482
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568714.1:26876:29142:1 gene:ENSDNOG00000002469 transcript:ENSDNOT00000002468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSFLVPSTISSPTLLKLLLSLGPETEWSLWQQPVLFQEAGTWMYLEASQKDCYRDTMLG
GYENMVPQGAFLQFSKMPQRAGNDPSGIPNTSEIEMEIRDMREKFLICVTKLVESKSYNS
KVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEKLIETTHRERDRVRYY
VHKEELFDILHDTHLKIGHGGRTRMLKELQGKYGNVTKEVIVLYLTLCKQCHQKNPVPKR
GLTPKPGTFKDLDSRCQVEVLDMQSNADGEFKFILYYQDHLTKFIILRPLKAKQAHEVVS
ILLDIFTILGTPSVLESDSGVEFTNQVVDELNEVWPDLKIVSGKYHSGQGQDSLERASQE
VKNMISAWVQSNHSHHWAEGLRFVQLMRNQAFDLSLQQSPYEAMFGCKAKLGLHSSNLPR
ETVAILQTEEELEIAEEQLENSLWIRQEERAEVGADRSDIDDDVDPTAEPSTSQGAPGLL
CC
Download sequence
Identical sequences ENSDNOP00000001918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]