SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000002906 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000002906
Domain Number 1 Region: 281-428
Classification Level Classification E-value
Superfamily SET domain 2.88e-27
Family Histone lysine methyltransferases 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000002906   Gene: ENSDNOG00000003768   Transcript: ENSDNOT00000003772
Sequence length 1471
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568390.1:30650:92861:-1 gene:ENSDNOG00000003768 transcript:ENSDNOT00000003772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIAIPLEVTTPDTSYSDMAAGSDPESVEASPAVNEKSVYSTHNYGTTQRHGCRGLPYAD
HNYGAPPPPTPPASPPVQTIIPRSDLNGLPSPVEERCGDSPNSEGETLPTWCPCGLSQDG
FLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSATESWDEELSPSTVLYTATQHTPTSIT
LTVNRVRRTKPKKRKKSPEKGRAAPKTKKIKNSPSEAQNLDENTTEGWENRIRLWTDQYE
EAFTNQYSADVQNALEQHLHSSKEFVGKPAVLDTINKTELACNNTVIGSQMQLQLGRVTR
VQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCV
DARTFGNDARFIRRSCTPNAEVRHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNY
KVDCACHKGNRNCPIQKRNPSATEPPLPPPPSLPTIGAETRRRKARRKELEMEQQNEVPE
ENNDQQPEEVPDKVTASSDHEEIDNPEEKLEEEKEEIVDDQENAAHIRRTREDRKVEAIM
HAFENLEKRKKRRDQPLEQSNSDVEITTTTSESPVVDETKTESPESEANNPTSNVAIPGT
PQSVGVNTRRSSQAGDVATEKPVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQASAQ
QAELSQAALEEGGNNNSVTPTEAGSIDSLGENRQLTGSDPAVVSVTGSHVNRAASKYPKT
KKYLVTEWLNDKAEKQECPVECPLRITTDPTVLATTLNMLPGLIHSPLICTTPKHYIRFG
SPFIPERRRRPFLPDGTFSSCKKRWIKQALEEGMTQTSSVPQETRTQHLYQSNENSKSSS
ICKDNADLLSPLKKWKSRYLMEQNVTKLLRPLSPVTPPPPNPGSKSPQLTTPGPSHPGEE
ECRNGYNLMFSPITSLTTTSRCNTPLQFECCNKRPLEIGQVLLQMKKEETKNQTSILIPP
YHHSNCHTLLCSSSEMESLFPLKTCDTEKYQTCCTSEDQFSLGKNIFESLEKYRRRHAVE
ENKILRTYPPLRVPLRIGPSPCHPREGMSEFYCRYTRGILGIVNLIRKGKMSPGGERACE
GVPSAPQNPPQRKKVSLLEYRKRKQEAKENSSGGGADSAQNKSKSAGAGQGCSNSVSDTG
AHGVQGSSARTPSSPHKKFSPSHSSMSHLEAVSPSDSRGTSSSHCRPQENISSRWMVPTS
VERLREGGSIPKVLRSSVRVAQKGEPSPTWENNTTEKDSDPADGEGPETLSSALSKGAAV
YSPSRYSYQLLQCDSPRTESQSLLQQSSSPFRGHPTQSPGYSYRTTALRPGNPPSHGSSE
SSLSSASYSSPAHPVSTDSLAPFTGTPGYYSSQPHSGNSTGSSLPRRSCPSSAASPTPQG
PSDSPTSDLVSQSSTGTLSSTSFPQNSRSSLPSDLRTISLPSAGQPPAYQASRVSAVSNS
QHYPHRGSGGVHQYRLQPLQGSGVKTQTGLS
Download sequence
Identical sequences ENSDNOP00000002906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]