SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000003600 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000003600
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 9.94e-57
Family N-terminal domain of cbl (N-cbl) 0.00000147
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 6.85e-47
Family SH2 domain 0.00000406
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 8.75e-43
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 1.41e-36
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000003600
Domain Number - Region: 927-970
Classification Level Classification E-value
Superfamily UBA-like 0.000165
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000003600   Gene: ENSDNOG00000004663   Transcript: ENSDNOT00000004664
Sequence length 983
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568291.1:134716:319791:1 gene:ENSDNOG00000004663 transcript:ENSDNOT00000004664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILNKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPHQDPLQIPHLSLPPVPPRLDLIHKGIVRSPCGSPTGSPKSSPGMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHVESVPSRDQPMPLEAWCPRDVFG
TNQLLGCRLLGDGSPKPGITASSSVNGRHSRMGADPVLMRKHRRHDLPLEGATVFSNGHL
GSEEYDVPPRLSPPPPATTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQLSHCHNVKPPVRSCDNGHCILNGAHGTSSEMKKSNLPELGIYLKGDVFDSASDPVPLP
PARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDAPPPSLPPPPPPARHSLVEHSKPP
GSSSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGENVKSNRTSQDYDQLPSSSDGS
QAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNN
VEVARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences ENSDNOP00000003600 XP_004460252.1.11602 XP_004460253.1.11602 XP_012381254.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]