SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000003637 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000003637
Domain Number 1 Region: 906-1198
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.47e-86
Family Complement components 0.000023
Further Details:      
 
Domain Number 2 Region: 1279-1407
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.97e-30
Family Alpha-macroglobulin receptor domain 0.0016
Further Details:      
 
Domain Number 3 Region: 742-794
Classification Level Classification E-value
Superfamily E set domains 0.0000042
Family SVA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000003637   Gene: ENSDNOG00000004709   Transcript: ENSDNOT00000004713
Sequence length 1441
Comment pep:known_by_projection scaffold:Dasnov3.0:JH574980.1:74863:250019:-1 gene:ENSDNOG00000004709 transcript:ENSDNOT00000004713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPPLLPAAHLLCMWTVALAAGPGPQFLVTAPGIIRPGGNVTVGVELLEHSPPEVTVKA
EVCKTVSNITTTVLEAEEVFKKGSFKTLILPSLPLNSADEIYELRVTGRAQDEILFSNST
LLSFETKRLSVFIQTDKPQYKPKQEVKFRVVTVFSDFKPYKTSLSILIKDPKSNLIQQWL
SEQNDLGVVSKTFQLSSHPILGDWSIQVQVTGQTYYQSFQVSEYVLPKFEVTLQTPLYCS
LNSKNLNGTVRAKYTYGKPVKGNVTLTFLPLSFWGVKKNITKVFKINGSAHFSFNDEEMK
EVMDFSNSLSEYVHLSSAGPVEILATVTDSLTGLSGNASSNVFFKQHDYIIEFFDYATVL
KPSLNFTATVKISRSDGNQLTLEERKNNVVITVTQKNYTDYWSTWSSRNQEMEDVQIINY
TVPQNGIFKIEFPILNDSSDLQLKAYFLDSVNNMAVHGMFVSPSKTYIKLRTTNENIKVG
SPFELVVTGNKQLKELSYMVVSKGQLVAVGKQNSATFSLTPENSWAPKACIIVYYVEDDG
EIINDVLKIPVQLVFKNEIKLFWSKANAEPSEKVSLRVSVTQPGSRVGIVAVDKSVNLMN
ASNDITMENVVHELELYNTGYYLGMFVNSFAVFQECGLWVLTDANLVKGYIDGVYDSAEI
AERFVEENEGYMVDFHDFSSVSNPHVRKHFPETWIWLDTNMGSRIYQDFEVIVPDSITSW
MATAFVISEDLGLGLTTTPVELRAFQPFFIFLNLPYSIIRGEEFALEVTILNYLKFATEV
NVIIGKSNDFDILMASNEINATGHQQTTLVPSEDGATVLFPIKPTHLGEIPITVTAISPT
ASDAITQRILVKAEGLEKSYSQSVFLDLTDNKKQTTLKTLNFSFPPDTVSGSERVHITAI
GDILGPSINGLASLIQMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNIKEKALSFMRQG
YQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDENVLHRTYTWLKGR
QKSNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNIDVQESINFLESEFN
RGISDNYTLALITYALSSVGNSKAKEALNMLTWRSEQEDGMQFWVSSVSKLSESWQPSSL
DIEVAAYALLSYFLQFRVSEGIPIMRWLSRQRNSLGGFASTQDTIVALKALSEFAALTNI
ERTNIQVIVMGPNSLNPVRFLIDTQNRFLLQTAELAVEQPIAVNISASGFGFAICQLNVI
YNVKSSGSSRRRRSLQNQEAFDLDVVVKDNEDDVNHLDLNVCTSFLGPARSGMALMEVIL
LSGFTVPTDAILKNEIIKKVEHDHGKINLYLDSVNETQFCVDIPAVRNFKVSNTQDASVS
IVDYYEPRRQAVRSYNSQVKLTSCDLCTDIVGCHPCGDGASGSIRHSSVIFIFCFTVLFF
L
Download sequence
Identical sequences XP_004476027.1.11602 ENSDNOP00000003637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]