SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004046 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000004046
Domain Number 1 Region: 291-356
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000858
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Domain Number 2 Region: 83-106
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000536
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number 3 Region: 225-248
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000209
Family CCCH zinc finger 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000004046
Domain Number - Region: 381-409
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00235
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004046   Gene: ENSDNOG00000005231   Transcript: ENSDNOT00000005222
Sequence length 493
Comment pep:novel scaffold:Dasnov3.0:JH569795.1:255582:257207:1 gene:ENSDNOG00000005231 transcript:ENSDNOT00000005222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPAAPTEAHEAAGAAAGAQAAEGAAPGPGLPAREASRPPAAPGPAPGPAPFGASGRGP
ARASGGGARPRCLPGRSGGSWTRQVVCRYYLHGLCKEGQNCRYSHDLSGRQPARQDRASP
PRASAGGGPSTAARGEPLTQEAAEAPPAASSRSSSLIGPAAERGFFEAEADNAGSEAAAA
GAESWGDAIEFVPGQPYRGRRVLSAPKPLAQSPVSEKEQVAAGSEKQLCPFAARGRCFRG
QNCAYLHGDACDLCGLQILHPLDAAQRAEHIRACIEAHEKDMELSFAVQRSMDKVCGICM
EVVYEKANPSDCRFGILSNCNHTYCLKCIRVWRRAKHFQYRIIKSCPQCRVTSNFVIPSE
FWVEEEEEKQKLIQQYKEAMSNKACRYFDEGRGCCPFGENCFYKHAYPEGPGVEPAGQGG
GAYSTYWNQLLEPVHVGAGSIPFRKIKKELVTRKLANWLFKHFLSLGGDACYFSKELWDL
LQYELEEYFNLNL
Download sequence
Identical sequences ENSDNOP00000004046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]