SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004936 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000004936
Domain Number 1 Region: 1091-1219
Classification Level Classification E-value
Superfamily TNF-like 1.04e-25
Family TNF-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1033-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004936   Gene: ENSDNOG00000006374   Transcript: ENSDNOT00000006372
Sequence length 1220
Comment pep:known_by_projection scaffold:Dasnov3.0:JH565847.1:1700153:1767562:-1 gene:ENSDNOG00000006374 transcript:ENSDNOT00000006372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGISLFVLLSSLRSGGIGANSTLHSWTTPQDENSQKVITSVSVLQNKVPSLQMLPTTQN
TSAEIATTPEARTSEESFQKSTLLPSETSVPAQGMRNLTPLFTEKAEDGMMKLETLAFPT
KSSLKFSSGAESAVLSNSTLKFLQSFARKSNQQASSLNSAGGIESRSPRESYLSRGDSSR
SQRTNYQKSSFETTRGKNWCAYVHTRLSPTVIRDNHVTYVPGERGPCGWSSGSCPQRAQK
ISSPVYRMQHKIVTSLEWKCCPGFIGAKCELKAQEQQQLIHSNQAESHVAVGQGTARQQQ
QQQDCGDTAVTQKMTDQMNHQAMKLTVLQKKIDNISLAVNDVRNTYSSLEGKINEDKGRE
FQSFLKDLKSKSIHSLVKDLVREQIKIFQNDMEETVAQLFKTLSSFSEDLENTKQIIQQV
NKSVSLIAIQQKSVLNQENRPILTDILDLKNHITNVKQEMIFTCKKPIKELEAKQTHLED
ALKQEHSTSILYYESFNQTLSKMKEVHEQLLSDEQVSDQKSTQAAKSVSNNITEYMSTLQ
ENIKKQNLMMLQMFDDLHIQDNKINNLTIILEMAKASVRDECEDMFSKCRNDFKFQIKDT
EENLHVLNQTLAEFLFPMDNKMDRMTEQLNDLTYDMGILQPLLEQGAYLRQTMAYEQPKE
IVAIREKVENLASAVNSLNFLIKELTKRHNSFGKETQSRSDALERRINEYALEMEDGLNK
TMTVINNAIDFIQDNYVLKETFRSIKQNPEVHHECSQKMEAILTFIPQFQRLNDSIQILV
NDNQRYNFVLQVAKTLADIPKDEKLNTSSFQNIYQMLNTTTSKVLKYQQNMNQLEEKILS
ATKISKNCETRLQGIESKVTQTLIPYYISLKKGSMSTNERDQALQLQVLNSRFKALEAKS
IHLSINFSLLNKTLYETLTMCHNATTSISGLNATIPHWIKESLPDIQLLQKGLTEFVESV
IEIKTQAALSNLTWYIERSLSGNLAQVVKSQKQVKSLLKKPNTFKKPTVNLTTVLIGRTQ
RNTDNAVFPATEEYSGCSKSPCQNGGTCINGRTTFTCACRHPFAGDNCTVKLVEENALAP
DFSKGSYRYAPMVAFFASHTYGMTTPGPILFNNLDVNYGASYTPRTGKFRIPYLGVYVFK
YTIESFSAHISGFLVVDGTDKLAFESENINSEIHCDRILTGDALLELNYGQEVWLRLVKG
TIPAKFPPVTTFSGYLLYRT
Download sequence
Identical sequences XP_004454436.1.11602 ENSDNOP00000004936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]