SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005051 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005051
Domain Number 1 Region: 484-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000321
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 521-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000013
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 102-132
Classification Level Classification E-value
Superfamily SET domain 0.00000641
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 144-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000368
Family Classic zinc finger, C2H2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005051   Gene: ENSDNOG00000006520   Transcript: ENSDNOT00000006522
Sequence length 619
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569063.1:255681:263822:-1 gene:ENSDNOG00000006520 transcript:ENSDNOT00000006522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHRSACLAAAAAMYGNARAPAASVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPRKK
VRLVRGELVDESGGSPLEWIGLIRAARNAQEQTLEAIADLPGGQIFYRALRDVQPGEELT
VWYSNSLAQWFDIPTTATPTHDEKGEERYICWFCWRTFKYPNSLKAHLRFHCGLSDGGGR
TFLHHEHAVRPGTAAAADGRRVSPKPSAPDFAAAVPGGPQRPHPQCPALPQACGTPEGIK
REASSAPSATAPSPGKWGPLRKGKEQHHHHHHHPKCLLAGDPLPPPPPGLPCSGALRGLP
LLPGSPEEVSAFKHVERAPPAASLPGARYAQLPPAAALPLERCALPPLDAGGLKAYPGGE
CSHLPAVMPAFTVYNGELLYGSPAAATYYPLKLHFGGLLKYPEPISYFSGPAAAAAALGP
AELGSLASIDREIAMHTQQLNEMAAGKGRGRLDAGVLPPALVAGGSAGGGGGGGGGSGKP
KTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTP
YRCEFCGKVLVRRRDLERHVKSRHPGQSLLPKADDGPGADSGYPPEPREPKSDNESDVDV
CFTDDQSDPEAGGGGQRDS
Download sequence
Identical sequences ENSDNOP00000005051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]