SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005610 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005610
Domain Number 1 Region: 744-757,787-1169
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.29e-108
Family Formin homology 2 domain (FH2 domain) 0.0000000000273
Further Details:      
 
Domain Number 2 Region: 92-445
Classification Level Classification E-value
Superfamily ARM repeat 1.9e-87
Family Diap1 N-terninal region-like 0.0000000000319
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000005610
Domain Number - Region: 489-567
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00602
Family HBL-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005610   Gene: ENSDNOG00000007243   Transcript: ENSDNOT00000007241
Sequence length 1277
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564669.1:543582:661545:-1 gene:ENSDNOG00000007243 transcript:ENSDNOT00000007241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPGGGPGPGRGTRDKKKGRSPDELPVAGGDGGKSKKFTLKRLMADELERFTSMRSKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEMERFQPLLD
GLKSGTSIALKARISPETGLKNRILSQEEREKTFFFKMGQNKKREIENDDMRVQLNVFDE
QGEEDSYDLKGRLDDIRMEMTDFSEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEAR
PQYYKLIEECISQIVLHKNGADPDFKCRHLQIDIEGLIDQMIDKTKVEKSEAKATELEKK
LDSELTARHELQVEMKKMESDFEQKLQDLRGEKETLGTEKQKIATEKQDLEAEVSQLTEE
VAKLSKELEDAKKEMDSLSAAVIAAVPPIISSAAVPPAPPLPADPGIPMPPPPPPLPGAV
SSIPPPPPLLPSSPLPGSASIPPPPPLPGSGSIPPPPPLPGSASIPLPPPLPGSTGIPLP
PPLPGVASIPPPPPLPGSASIPPPPPFPGSTGIPPPPPLPGSGGIPPPPPPLPGGPGLPP
PPPPLPCGPGIPPPPPFPGGPGVPPPPPGMGMPPPPPFGFGVPAAPVLPYGLTPKKLYKP
EVQLRRPNWSKFVAEDLSQNCFWTKVKEDRFENNELFAQLTLTFSAQTKTSKAKKDQEGG
EEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKTVILEVNEAVLTESMVQNLI
KQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGAVPRLRPRLNAILFKLQFSEQVENIKP
EIVSVTAACEELRKSESFSNLLEITLLVGNFMNAGSRNAGAFGFNISFLCKLRDTKSTDQ
KMTLLHFLAELCEKDHPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQN
FPAATDEKDKFVEKIHSFVKDAQEQYNKLRMMHSNMETLYKDLGEYFLFDPKKLSVEEFF
IDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDE
TGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMTAVPAKKPNISE
GVTTILEETKELVGRAS
Download sequence
Identical sequences ENSDNOP00000005610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]