SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005926 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005926
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 3.83e-64
Family Phosphotyrosine-binding domain (PTB) 0.0000000059
Further Details:      
 
Domain Number 2 Region: 473-545
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-19
Family SH2 domain 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005926   Gene: ENSDNOG00000007651   Transcript: ENSDNOT00000007652
Sequence length 549
Comment pep:known_by_projection scaffold:Dasnov3.0:JH566607.1:3369:8933:-1 gene:ENSDNOG00000007651 transcript:ENSDNOT00000007652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPVDDSPTTLCS
FFPRMSNLKLANPAGGRSGPRGEPGRAAEDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTISTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGATPGAVRPTPPSAQTPSHLGATLPVGQPVGGDTEVRKQMPPPPPCPAGR
ELFDDPSYVNVQNLDKARQAGGGGGPSNPTINGCTPRDLFDMKPFEDALRVPPPPQSLSM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTTGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHR
Download sequence
Identical sequences ENSDNOP00000005926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]