SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006418 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006418
Domain Number 1 Region: 438-680
Classification Level Classification E-value
Superfamily vWA-like 3.56e-70
Family Trunk domain of Sec23/24 0.00015
Further Details:      
 
Domain Number 2 Region: 186-455
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.46e-37
Family beta-sandwich domain of Sec23/24 0.0042
Further Details:      
 
Domain Number 3 Region: 686-781
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.01e-37
Family beta-sandwich domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 4 Region: 890-1031
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.85e-30
Family C-terminal, gelsolin-like domain of Sec23/24 0.0022
Further Details:      
 
Domain Number 5 Region: 783-889
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.45e-26
Family Helical domain of Sec23/24 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006418   Gene: ENSDNOG00000008271   Transcript: ENSDNOT00000008285
Sequence length 1035
Comment pep:known_by_projection scaffold:Dasnov3.0:JH578153.1:2216480:2328957:1 gene:ENSDNOG00000008271 transcript:ENSDNOT00000008285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQSQPGIGLSPPHYGHYGDPSHAASPPGMMKPAGPLGAVAPAGMMPPG
PPPPGTHQFGQNGAHASVHLPQRFPGPPPVSSVAQSYTPYPPSTQSSYPSPVSTSSTTQL
GNQLSAMQINSYGSAMAPHGLGPPGPPPTAPFQGPQRPQQPSILQPGSQVLPPPPTALNG
PGTSPLSPPTHRQDGPPGAAPPSAQYQPPSLPGQTLGTGYPPQQAASYGPQMVGTQLTYP
GGFPGGPAQMAGPPPPQKKLDPDAIPSPIQVIENDRAARGEQAYTTNTRGQVPPLVTTDC
VIQDQGNASPRYIRCTTYCFPCTSDMAKQTQIPLAAVIKPFATIPSNEVPLYLVNHGESG
PVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSL
GSYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTLLEKLPKEEQEE
TSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNL
LDQIPEMFADSNENETVFAPVIQAGVEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDK
KLINTDKEKLLFQPQTNVYDSLAKECVAHGCSVSLFLFPSQYVDMASLGLVPQLTGGTIY
KYNNFQMHLDSQQFLNDLRYDIEKKIGFDAIMRVRTSTGFRATDFFGGIFMSNTTDVEMA
AIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLSDLYKS
CETDALINFFAKSDIAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPD
AMKVLPVYMNCLLKNCVLLSRPEIPTDERAYQRQLVMTMGVADSQLFFYPQLLPIHMMDI
KSATFPAAVRCSESRLSEEGIFLLANGLNMFLWLGVSSPTELIQGIFNVPSFAHINTDMT
LLPEVGSPYSEKLRMIMNIMQQKRPYSMKLTVVKQREQPEMVFRQFLVEDKGLYGGSSYV
DFLCCVHKEICQLLN
Download sequence
Identical sequences ENSDNOP00000006418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]