SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000008183 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000008183
Domain Number 1 Region: 10-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-28
Family Hormone receptor domain 0.00031
Further Details:      
 
Domain Number 2 Region: 125-392
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000275
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000008183   Gene: ENSDNOG00000010557   Transcript: ENSDNOT00000010563
Sequence length 422
Comment pep:known_by_projection scaffold:Dasnov3.0:JH565077.1:579978:592853:1 gene:ENSDNOG00000010557 transcript:ENSDNOT00000010563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRTWGACILCLLSPVPIVLGLAPPECDFILQLREDEHACLQAADGPPNSTPGCPRTWD
GLLCWPVAGSGEWVTLPCPDFFSHFSPEPGAVKRDCTITGWSEPFPPYPVACPVPLELLA
EEKSYFSTVKIVYTVGHSVSIAALFIAIALLVALRRLHCPRNYIHVQLFSTFILKAGAVF
LKDAALFHGDNTDHCSFSTVLCKVAVATAHFATMTNFSWLSAEVYLTCLLASTSPGARRP
FWWLVLAGWGFPLLFTGTWVGCKLAFEDVACWDLDDSAPSWWIIKGPIVLSVGVNFGLFL
NIIRILLRKLEPAQGSRHTQSQYWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLGIRLPLE
LGLGSFQGFIVAILYCFLNQEVRTEISQRWHGHDPELLPARRTCIKWMMPSGSGSKVLTS
VC
Download sequence
Identical sequences ENSDNOP00000008183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]