SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009194 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009194
Domain Number 1 Region: 386-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-36
Family Calponin-homology domain, CH-domain 0.000097
Further Details:      
 
Domain Number 2 Region: 86-241,386-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 
Domain Number 3 Region: 756-789
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000165
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000009194
Domain Number - Region: 790-818
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00499
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009194   Gene: ENSDNOG00000011849   Transcript: ENSDNOT00000011855
Sequence length 1992
Comment pep:known_by_projection scaffold:Dasnov3.0:JH567220.1:565014:767809:-1 gene:ENSDNOG00000011849 transcript:ENSDNOT00000011855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESKNNTTNQAHVLFDRFVQATTCKGTLKAFQELCDHLELKPRDYRSFYHKLKSELNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGTIDHISIRQLQLILLKVALILGIEIHVN
VEFRGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRHTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYTDTELLLSRENVDQEALLSYAREAADFSTQQQLPTLDFAINH
YGQPDVAMFDFTCMYASENAALVREQHGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNININFLR
PSQVRHLYDTGGTKDIHLEMENLVNSRITPKLTRNESVARSSKLLGWCQRQTDGYAGVSV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDALDLNAEEKAVLIASTKSPISFLSKLGQS
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGPRGERPPLASSLTDRRVDAGAGHQN
KVKYMATQLLAKFEENAPPQSTGLRRQSSIKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCEYCATTLRLSAYAYDIEGGKFYCKPHYCYRLSGYAQRKRPAVAPLSAKE
ARGPLQDGPTADGGGRAGAAPCAAERTPGSSVNGLEEPSIAKRLRGTPERIELENYRLSV
KQAEGLEEVPEETQAEHNLSSVLDQGTEEDAASSSSESDMEEEEGPRLPSSDLGGVPWKE
AVRIHALLKGKSEEEAEASQHYEPGDGEEEEEEEEEEEDYDNEEEESSEAGRQRLQPVIN
PADPLEIQADVHWTHVREKAEEERAMPASGSSPSGVSFNKNDLEEDVDSEPAEIEGEAAE
NGDTGDTGAELDDDQHWSDDVPSDAETELRLRHQEEVEAELELRVSENEGETPPPTPKRQ
ERGPSPASSPSRSPEEQAVLFSPLQSPVAEGARTPFAPAASKASSPEQRFFPEPLLPEET
PRANVPTGQQPVLSPIRCQPMALPEARTPPSPAGLRLVPPPATPASPRAQLPICSQPQPA
SEANMPSPTVPSPTASPIRFQPGPANTSTPLAPRPEKSHREPRDRLDEALKRSDLVEEFW
VKSAEIRRSLGLTPVDRGKGPEAGPPAPTSLASYPVEQPRRDEGLRLLKPPPAPKRLGLA
AWEGTQPSLLTPKSPSDRELRSAPDERRDLSSSSGLGLQGSSSNMRTLGSQSFNTSDSAL
LTPPSSPPPPPPDEEPATLGRTRPQPGQRQGTAPRAPAGPPPPPAAAILRPPREPARPPR
EEARKSFAESVDEIPFADDVEDTYDDQTEDSSLQEKFFTPPSCWARPEKPLGPAPAKENG
RLPAPEAGVLPQKRGLPLVSPEAKELAEERMRAREKRVKSQALRDAMAQQLSRMKEMEMA
RPPRSGAHKASSVPPKGQERGPEPPGRPSLGGPEQPAPKREAAPPPAEPEGPDGSVTSSE
GSSGKSKKRSSLFSPRKSKKEKKPKGNGLSAERPSPSLPEEAAAKPRSLWKSVFSGYRRD
KKKKGDDKSCSSTPSSGATAGSGRRQVSPVVRAELQLRRQLSFSEDSDLSSDDILDRSSQ
KSRREPRTYTEEELNSKLTRRVQKAARRQAKQEELKRLHRAQIIQRQLEQVEEKQRQLEE
RGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARELELEDRQSRL
QQELRERMAVEDHLKTEEELSEEKKILNEMLDVVEQRDSLVALLEEQRLREKEEDRDLEA
AMLSKGFSLNWS
Download sequence
Identical sequences ENSDNOP00000009194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]