SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000009964 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000009964
Domain Number 1 Region: 347-421
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000018
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 145-221
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000745
Family Rhamnogalacturonase B, RhgB, middle domain 0.019
Further Details:      
 
Domain Number 3 Region: 981-1070
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000224
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 4 Region: 900-972
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000333
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000009964
Domain Number - Region: 827-886
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00231
Family Cna protein B-type domain 0.011
Further Details:      
 
Domain Number - Region: 435-488
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00235
Family Cna protein B-type domain 0.007
Further Details:      
 
Domain Number - Region: 234-317
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00392
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number - Region: 69-133
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0239
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000009964   Gene: ENSDNOG00000012840   Transcript: ENSDNOT00000012846
Sequence length 1239
Comment pep:novel scaffold:Dasnov3.0:JH570565.1:1394523:1451030:1 gene:ENSDNOG00000012840 transcript:ENSDNOT00000012846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARGGAGSLRGSSGRGRAMRAGRGAGPPGPAVVAAAVVLLLGGVGPARGSEDIVVGCGGF
VKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEP
TTVELYVDGISDICTKGGDINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTDAKIQS
TVTQPGGKFAFFKVLPGDYEIIATHPTWALKEASTTVRVTNSNANAAGPLVVAGYNVSGS
VRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPRDQSLVYLCYVVSKEDGSFSFY
SLPSGAYTVIPFYRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGKVLNGPEGE
GVPEAVVTLNNRIKVKTKADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLAD
IIATGFSVCGQISIVRFPDTTKQMSKYKVVLSSQDKDKSLVTVESDAHGSFCFKAKPGTY
SVQVTVPEAEARAGLALKPPAFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVSL
QSLSRQGEKRSLQLSSKNSMTFTFDSVLPGKYKLSIVHEDWCWKNKSLEVEVLEDDVSAV
EFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHR
FEQAFYTYDTSSPSILTLTAIRHHVLGAITTDKMMDVTVTIKSSIDSEPALVLGPLRSVQ
ELRREQQLAEIESRRQEREKNSRGDGGEGGAKAPVQEMVDELQGPFSYDFSYWARSGEKI
TVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGA
SSPLITVFTDDKGTYSVGPLHSDLDYTITSQKEGYVLTAVEGTVGDFKAYALAGVSFEIK
AEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIE
VQEGQTLRIAITGFRTAYSCYGTVSSLNGDPEQGVAVEAVGQNDCSIYGEDTVTDEEGRF
RLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNV
ITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQY
DYVLPQVSFTAMGYHKHVTLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPL
LLQFTSRLQGVRTLGQAASDNSGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences ENSDNOP00000009964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]