SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010201 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010201
Domain Number 1 Region: 66-173
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 487-588
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 198-300
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 4 Region: 353-455
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010201   Gene: ENSDNOG00000013157   Transcript: ENSDNOT00000013157
Sequence length 591
Comment pep:known_by_projection scaffold:Dasnov3.0:JH562474.1:322946:331111:-1 gene:ENSDNOG00000013157 transcript:ENSDNOT00000013157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSKRPPTGWMCKEAEMRAGPQPDEKSRGWRPGEKSTTLSPPPPALSFLLLLPLAGALQ
PSPLPFPELRLVGGPSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGRGPILLDNVECRGQEATLSECGSRGWGVHNCFHYEDVAVLCNEFLPTEPPTRK
VLTSRMPPTALQNGKGEGSVRLVGGAGRCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQ
LGCGAALAATTNAFFGYGTGHILLDNVHCEGGEPRLAACLSLGWGVHNCGHHEDAGAFCA
VLSSPTLTALLPSATREEWAQNTEPAATGVGAWPSKEMALLTTAAWAAGKKSGRLRLVGG
PGPCRGRVEVLHAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLD
NVGCAGTEARLSDCFHLGWGQHNCGHHEDAGALCAVLAEPGPEELGLQVQQDGSETTRVP
TPRPRDGHLRLANGAHRCEGRVELFLGQQWGTVCDDAWDLRAASVLCHQLGCGQALAAPG
EAHFGPGRGPILLDNVKCRGDESTLLLCSHIRWDAHNCDHSEDASVLCRLS
Download sequence
Identical sequences ENSDNOP00000010201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]