SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010505 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010505
Domain Number 1 Region: 1-285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-93
Family Protein kinases, catalytic subunit 0.00000147
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000010505
Domain Number - Region: 329-376
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010505   Gene: ENSDNOG00000013545   Transcript: ENSDNOT00000013544
Sequence length 623
Comment pep:known_by_projection scaffold:Dasnov3.0:JH575683.1:289812:355775:1 gene:ENSDNOG00000013545 transcript:ENSDNOT00000013544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHA
NVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHG
FFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSP
IDVWAVGSIMAELYTFRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQ
CVPINLKTLIPNASSEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSSHLLESK
QTLNKQLQPLESKPSVVELEPKLLPEITDQPVGQPQANLSHQPLQPLPLSQNLSVQQPPK
QQSQQPQQLTVLPRIGKALPAKPNGTLSHKSARRRWGQSVFKSGDSWEEFDDYDFGASHS
KKPSMGVLKEKRKKDFPFRLPDSVASGSVHSPDENKNLPAAVPRKSDSELSSASTAKQYY
LKQSRYLPGVNPKNVSLLASGKNVHPYTWNNQLFPKSLEPIGTELAFKRNNAGNLGSYTT
YNQSGYIPSFLKKEVGSAGQRIHLAPLGATTAEYTWNTKTGRGQFSGPTYPPTAKNLSLV
SRAQPVHSVHGRTDWVAKYGGHR
Download sequence
Identical sequences XP_004477010.1.11602 ENSDNOP00000010505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]