SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000010607 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000010607
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000447
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 2 Region: 354-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 410-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000010607
Domain Number - Region: 457-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 25-45,89-166
Classification Level Classification E-value
Superfamily Sialidases 0.00137
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000010607   Gene: ENSDNOG00000013686   Transcript: ENSDNOT00000013683
Sequence length 531
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569959.1:1155111:1219611:1 gene:ENSDNOG00000013686 transcript:ENSDNOT00000013683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLAAGDYDICKSWVTSDEGPTWEFYACQPKVMRLKDYVKVKVEPLGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMPAR
RARDLSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKDFFTLTDLRLRLLRPALGGTYVQRENLYKYFYAISNIEVMGRCKCNLHANLCSARE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSAFGNCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSMHD
RCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCLNGGTCVQNQRCACPR
GYAGLRCEQPRCDPTDDGGGLDCDRAPGAAPRPATLLGCLLLLRLAACLGC
Download sequence
Identical sequences XP_012384296.1.11602 ENSDNOP00000010607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]