SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012065 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012065
Domain Number 1 Region: 706-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000809
Family Laminin-type module 0.0000555
Further Details:      
 
Domain Number 2 Region: 602-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000173
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 164-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000262
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 4 Region: 813-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 762-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 6 Region: 325-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 276-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 8 Region: 651-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 9 Region: 861-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 10 Region: 220-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000012065
Domain Number - Region: 1163-1401
Classification Level Classification E-value
Superfamily Tropomyosin 0.00517
Family Tropomyosin 0.00095
Further Details:      
 
Domain Number - Region: 1055-1185
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0103
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012065   Gene: ENSDNOG00000015562   Transcript: ENSDNOT00000015565
Sequence length 1484
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570121.1:3587501:3735231:-1 gene:ENSDNOG00000015562 transcript:ENSDNOT00000015565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPDSFAIYKRMREDGPWIPYQYYSGSC
ANTYSKANRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASKCVKNEFGK
LVCDCDHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCSGRSQQCYFDPELYRSTG
HGGHCTNCQDNTDGANCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDNYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCNPSGSIDECNIETGRCVCKDNVEGFNCERCKPGFF
NLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSDFQIDEDGWRAEQRDGSEASFEWSS
DRKDIAVISDSYFPRYFIAPVKFLGKQVLSYGQNFSFSFRVDRRDTRLSAEDVVLEGAGL
RVSVPLIAQGNSYPSETAVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLGSARPGPGTPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGACNCRDNTAGPHCEKCSDGFFGDSTVGTASDCQPCPCPGGSSCA
VVPKTKEVVCTNCPTGTTGKRCEFCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACACNPYGTVKQQSNCNPVT
GQCECLPHVTGRDCGACDPGFYSLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCEQCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGHCECKEGFVGHRCDQCEENYFYN
RSWPGCQECPACYRLVKDKASKRSLFGKWGKEQSLLKNGRERSCKFIKQSCTCAEFPSNT
PLSTHHTVVECLLQTFFDSFIELQFSEYKCFTSLGFPPFLPCWLSSRSQGCMILSDYLFS
FQQLQIELEKAKIAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTA
NDTSTEAYNLLLKTLAGENQTAFEIEELNRKRYRAMELLFDSIPKTAEESVGYTGKSKSS
NYILAVLSKINALTLSSQNEANKIKKEAENLDSLIDQKLKDYEDLREDMRGKEFEVKSLL
EKGKTEQQTADQLLARADAAKALAEESAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAE
EALRKIPAINQTIAEANEKTREAQLALGNAAADATEAKNKAHAAEQIATAVQKNATSTKA
EAERTFAEVTDLDREVNSMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARK
AKSSVTSLLNIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEA
KKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
Download sequence
Identical sequences ENSDNOP00000012065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]