SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012096 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012096
Domain Number 1 Region: 130-307
Classification Level Classification E-value
Superfamily MIR domain 6.54e-51
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 995-1108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.92e-18
Family SPRY domain 0.04
Further Details:      
 
Domain Number 3 Region: 3916-3994
Classification Level Classification E-value
Superfamily EF-hand 0.0000000023
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 4 Region: 572-720
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 13-94
Classification Level Classification E-value
Superfamily MIR domain 0.00000366
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 2063-2133
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000484
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 7 Region: 344-461
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000523
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000012096
Domain Number - Region: 1385-1448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00257
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012096   Gene: ENSDNOG00000015577   Transcript: ENSDNOT00000015600
Sequence length 4875
Comment pep:known_by_projection scaffold:Dasnov3.0:JH571788.1:3115191:3662841:1 gene:ENSDNOG00000015577 transcript:ENSDNOT00000015600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWT
IHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGS
EAAQGNYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETL
RVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDV
GVRKEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQSVDAKSVRMGSIQRKAIMHHEGHMD
DGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKTPAVDLPIESVSLSLQDLI
GYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGR
EAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLV
ESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGR
DLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWAST
EGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLD
LSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYA
PCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLER
IREKLAENIHELWVMNKIELGWQYGPVLRDDNKRQHPCLVEFSKLPEQERNYNLQMSLET
LKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKL
AENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLG
YGYSLEAPDQDHAARAEVCSGTGERFRIFRAEKTYAVQAGRWYFEFEAITAGDMRVGWSR
PGCQPDQELGADECAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNG
EILLDDSGSELAFKDFEVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPF
AVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDI
MFYRLSMPIECAEVFSKTAAGGLPGASLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRV
EKEKETTKAEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDY
LMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDSGFDLDRVRTVTVTLGDEKGKVHER
FSIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAASGLLTFTANGKELSTYYQVEPST
KLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWS
RMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHT
LRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRSGYYDLLIDIHLSSYATA
RLMMNNEFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSVNHECYQ
HSPEFPLDILKAKTIQMLTEAVKEGILHARDPVGGTTEFLFVPLIKLFYTLLIMGVFHSE
DLKHILQLIEPRVFKEAAPTEEEGGVPERELSTEELRPEGAAEEEARGGKRPKEGLLQMK
LPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAAL
TARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSL
DGNSDLTIRGRLLSLVEKVTYLKKKQAEKSVESDSKKSSTLQQLISETMVRWAQESIIED
PELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKE
EEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCC
RFLCYFCRISRQNQKAMFDHLSYLLENSSVGLGTASPAMRGSTPLDVAAASVMDNNELAL
ALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEE
NANVVVRLLIRRPECFGPALRGEGGNGLLAVMEEAIKIAEDPSRDGPSPASGSSKTPDSE
EEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGV
ISIAFQMPTVAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPD
LRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRL
SKGCSLTKAQRDSIEICLLSICGQLRPSMMQHLLRRLVFDIPLLNEHAKMPLKLLTNHYE
RCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGA
LPPDYMESNYVSLMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMD
KLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREG
DSMALYNRTRRISQTSQVSVDAAHGYSPRATDMSNVTLSRDLHSLYRFLSHNHYCGWVKI
KIFNLNSPGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAVSSSRGFKDLELD
TPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQ
YFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCL
HILGQTLDARTVMKTGLETVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQI
INYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRS
ALGECLAALAGAFPVAFLETHLDKHNIYSIYNTKTARERAALSLPANVEGVCPNIPSLEK
LMEDIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEYGPENNMERAEMCCTAVNSEHM
NTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMV
VSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAE
ELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMK
RKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSMKDTEEEVRDIIRSNI
HLQGKLEDPAIRWQMALYKDLPNRTEDTSDPEKTVERVLDIANVLFHLEQKYTSLSRRYY
SLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEE
HYFEDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYAD
IMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGP
MVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNK
AEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIIS
TVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQ
SLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNG
TIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAME
GHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDISFNVAVLLTNLSEHMPNDT
RLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFI
FDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSTTKEEGEKEKPEEQEPRM
GFFSILTVRSALFALRNNILTLMRMLSLKSLKKQMKRVKKMTVKDMVMAFFSSYWSIFLS
LLHFVASVFRGFFRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEVERKA
MESALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSELMSNQVPIP
EVQEKLQEQKKVKEEEKEEKEETKSEPEKAEGEDGEKEEKNKEDKGKQKLRQLHTHRYGE
PEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKE
LPTRSSSENTKVSSLDSGSPRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYC
LKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRK
VMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGV
VFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVG
LLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIE
DPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICG
IGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFF
PAGDCFRKQYEDQLN
Download sequence
Identical sequences ENSDNOP00000012096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]