SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012277 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012277
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 3.12e-52
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 417-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000158
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000012277
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily L domain-like 0.000476
Family Ngr ectodomain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012277   Gene: ENSDNOG00000015831   Transcript: ENSDNOT00000015827
Sequence length 660
Comment pep:known_by_projection scaffold:Dasnov3.0:JH575011.1:1287755:1289737:1 gene:ENSDNOG00000015831 transcript:ENSDNOT00000015827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQTTRWPTHGAFFLKSWLIISLGLYSQVSKLLACPNVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPM
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGITEGTFSHLTKLKEFSIVRN
SLSRPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPLFAPAPSPVSATTQIPMLSVPTPSRSYTPVTPTTLNLPTIPDWDGRERVTPP
LSERIQLSIHFVNDTSIQVTWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPKSTYRICLVPLDAFNYRAVEDTICSEATTLASYLNNGSNTASSHEQTTSHSMGSP
FLLAGLIGGAVIFVLVVLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVSDLEHCPT
Download sequence
Identical sequences ENSDNOP00000012277 9361.ENSDNOP00000012277 XP_004476064.1.11602 XP_012374056.1.11602 XP_012374057.1.11602 ENSDNOP00000012277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]