SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012494 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012494
Domain Number 1 Region: 1128-1307
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00073
Further Details:      
 
Domain Number 2 Region: 688-803
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.28e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0016
Further Details:      
 
Domain Number 3 Region: 910-1043
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-23
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 467-578
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-22
Family Pleckstrin-homology domain (PH domain) 0.000013
Further Details:      
 
Domain Number 5 Region: 1439-1579
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-20
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 6 Region: 7-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.13e-16
Family SAM (sterile alpha motif) domain 0.0000465
Further Details:      
 
Domain Number 7 Region: 589-687
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000237
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 8 Region: 1020-1114
Classification Level Classification E-value
Superfamily PH domain-like 0.000000255
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000012494
Domain Number - Region: 1349-1416
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.031
Family Ras-binding domain, RBD 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012494   Gene: ENSDNOG00000016109   Transcript: ENSDNOT00000016111
Sequence length 1704
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568271.1:610620:825577:-1 gene:ENSDNOG00000016109 transcript:ENSDNOT00000016111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASEVNVDIKDFLMSINLEQYLLHFREFGFNTVKDCASINDSVLHKIGISPTGHRRRI
LKQLQIILSKMKDIPIYANVHKTKKNDETSKNGHTLSSDQNAGLELSDSVSVQVPSPIQL
DTITENLDQNTVSVENSQSPKSDDKLSPPKHHFLIPGEEPHLNLGSFQDSFLGSENITTE
SLNSKKAVYCTPEEEQTEEDYLISENLSKLPAADPECLSSPSSCSVSEANSGNGPNSLLE
SSPPSPFFQFQGEMVVNDLYIPSSPNLAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTRG
IPGSYCRERRKIAASTGKPLAQQNSNEENSSSIIPYGETFLFQRLENSKKKSIKNEFWTH
EETLKGRAATERNTHLVKSSIYDNRKEKTSEDKVEDIWIPREDKNNCPMDSASDSEYSTV
EECFQSLRRRNSKPSKSKTQKAVNLDLINRHSFPLSSASGNTDASTFPSNAISPYACFYG
SSARKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPISAISTVRVQ
GDNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKLQSLTSRSSAVVAPEKYGYLELRG
YKTKIFTVLSGNSVWLCKNEQDYKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFS
FTAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCSAPDPDWASINLCVV
ICKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELH
MDSPVEKRKIFITHKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADV
MCATGDPMHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEVGLSQESTQSTFLCDF
LYQAISAASKLSSEKKLLEDSETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAI
HKEDIYLNTGPIFTFEIYLPSERVFLFGAETTQAQRKWTEAIAKHFVPFVAESLTEADYD
LIGQLFYKDCHALDQWRRGWFAMDKSSLRFCLQTQEAQEDRMHLRRLQELTFSTMVQNGE
KLDVLLLVEKGRTLYIHGHTKLDFTVWHSAIEKAAGTDGNALQDQQLSKNDVPIIVNSCI
AFVTQYENKGLGCKYIYEKNGDPVHITELLESFKKDARSFKLRAGKHQLEDVTGVLKSFL
SDIDDALLTKELYPYWISALDTQDDKERTKKYAAFIRTLPGVNRATLAAIIEHLYRVQKC
SEINHMNAHSLAMVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEEQVKQMDIENSF
ITKWKDTQVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTNGDI
WATFEVIENGELERPLHYTENVLEQVLQWSSLAEPGSAYLVVKRFLTIDMIKHYSERRVL
ECIKEGVLKIKEEPSKILSGNKFQDRYFVLRDSHLFLYKDLKSSKHDKMFSLRSVKFYLG
VKKKTKPPTSWGLTAYSEKHHWHLCCDSSQTQMEWMANIFIAQHENDICPPAGKERKRSI
TKNPKIGGLPLIPIQHERNVTQTQRNIESARAELERLRVSEKHDKEFVDSNLKEKASIVA
HCLEHKEEKLRNRTRKYRSFNCLEDSGAGIPQGQQKGHKVLKTLRKPEDRNYSATLDSDN
KLPSKVIEELSVVLQRTRNLPKEL
Download sequence
Identical sequences ENSDNOP00000012494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]