SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000012578 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000012578
Domain Number 1 Region: 477-523,590-770
Classification Level Classification E-value
Superfamily VPS9 domain 3.79e-50
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 40-164
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000175
Family SH2 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 787-868
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000336
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000012578   Gene: ENSDNOG00000016218   Transcript: ENSDNOT00000016219
Sequence length 892
Comment pep:known_by_projection scaffold:Dasnov3.0:JH562124.1:1151625:1379619:1 gene:ENSDNOG00000016218 transcript:ENSDNOT00000016219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRHQDDDDGEDKGVTASPRDSGYDSLCNRLSILDRLLHTHPVWLQLSLSEEEAAQILQP
QPPGIFLVRKSTKMQKKVLSLRLPCEFGAPLKEFAIKESTYTFSLEGSGISFADLFRLIA
FYCISRKLRDVLPFTLKLPYAISTAKTEAQLEELAQLGLNFWSSPADSQPPNPPPPHRPL
SADGVCAASRQLCLINGVHSIKTRTPSELECGQSSRALCFINPLFLKVHSQDLKRPGPRT
PNVNGTERPRSPPPRPPPPAINSPHTSPQLSAPGPRPSMPETVNHNKQGSGAALGAKPAP
VPPPRRKKHTSLLQAEGGGQPLTGGRPGPGPQPERPGAAASPGGAPPGEGADCTRARPPA
AESRPPWNGGRQRLSDMSLSTSSSDSLDFDRSMPLFGYEADTPSSQEDYEGESDQETMAP
PVKSKKKRHSSFVLPKLVKSQIRKMSGMFSNFMTPEKRMVRRIAELSRDKCTYFGCLVQD
YLSFLQENKECHVSSTDMLQTIRQFMTQVKNYLSQSSELDPPESLIPEDQIGGLPDSFHF
SWNLQNPKPQIFRELPVTKKSHLLLCHDRDKRGLAKCCVVMAAADVVLEKAMHKCILKPL
KGYVEATLKDFHMADGSWRQLKENLQLVRHRNPQELGVFAPTPDFVDVEKIKVKFMTMQK
MYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVIAQCDMLELDTEIEYMME
LLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRDTLRQWHKRRTTNRTVPS
VDDFQNYLRVAFQEVNSGCTGKTLLVKPYVTTEDVCQLCAEKFKVGDPQEYRLFLFVDET
WQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTSS
Download sequence
Identical sequences ENSDNOP00000012578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]