SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013106 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013106
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.96e-59
Family Dystroglycan, domain 2 0.000000357
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily Cadherin-like 2.04e-18
Family Dystroglycan, N-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 5.18e-18
Family Dystroglycan, N-terminal domain 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013106   Gene: ENSDNOG00000016917   Transcript: ENSDNOT00000016917
Sequence length 895
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564313.1:2120489:2208154:-1 gene:ENSDNOG00000016917 transcript:ENSDNOT00000016917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVCLPLLSPLWGRTFLLLLFVAVAQSHWPSEASEAVRDWENQLEASMHSVLSELHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASNGEVIKVSAVGKEALPSWLHWDPQSHILEGL
PLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHNEPQSVRAASPDPGEAVSS
ACAADEPVTILTVILDADLTKMTPKQRIELLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWRLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAVQEPPSRIVPTPTSPAIAPPTETMVPPVRD
PVPGKPTATIRTRGAIVQTPTLGPIQPTRVSETGTTVSGQIRPTMTIPGYVEPTAIATPP
TITTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRI
RTTTSGLPRGGEPNQPPERKNHIDRVDAWVGTYFEVKIPPDTFYDKEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDKAPAHFKAKFMGDPALVVNDIHKKISLVKKLAFAFGDRNCSTVTLQNITRGSIVVEWT
NNTLPLEPCPKEQITGLSRRITEDDGKPRPAFSNALEPDFKAVSVAVTGSGSCRHLQFIP
VAPPRRMPSEAPPTEVLDRDAEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences XP_004451934.1.11602 XP_004451935.1.11602 XP_004451936.1.11602 XP_004451937.1.11602 XP_004451938.1.11602 XP_004451939.1.11602 XP_012378142.1.11602 ENSDNOP00000013106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]