SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000013802 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000013802
Domain Number 1 Region: 142-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-33
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 296-408
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-30
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 459-571
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.12e-27
Family Frizzled cysteine-rich domain 0.00023
Further Details:      
 
Domain Number 4 Region: 256-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000013802
Domain Number - Region: 414-454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00288
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000013802   Gene: ENSDNOG00000017789   Transcript: ENSDNOT00000017789
Sequence length 573
Comment pep:novel scaffold:Dasnov3.0:JH566902.1:116746:122543:1 gene:ENSDNOG00000017789 transcript:ENSDNOT00000017789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDRSDVILRVEATEPSKTEFCNPAFEPGTEPARPPPAFPEDASGSSRAPWHGRRPRGLR
PDCHFSWLCVLLLASLLLLLLGLLVAVTLARLLPGASHSPLPARDPRATAGTPPRTITTS
QATGTPKAQQEARMSPTSQSACGGLLPGPRGFFSSPNYPDPYPPNTRCEWHIQVATGHTV
QLKINTLSTESVTSCLFDRLEISPDPEGPLLRVCGRVPPPTLNTNASHLRVAFISDSSVE
GFGFHAWYQAVAPGHGSCAHDEFPCDQLVCLLPDSVCDGFANCADGSDEANCSAKFPGCG
GNLTGLQGNFSTPSYPHQQLCTWHISVPAGYSIELQFHNFSLAAQDGCKLDYVEVYESSP
SGTLSRLGRFCGAEPPARLSSPHRDLAVIFRTRHGVSSGGFSATYQALNATEKPCGPGEF
CQDGGCKDLPWVCATWRGCADGSAAHNCSGPLFPPPELACEDIQVEMCIGLSYNTTAFPN
IWVGLATQGEVVEVLRGYESLTSLPCYQAFRRLLCGLLVPRCALLGSVLPPCRSVCQEAE
RQCLPSLALLGTPWPFNCNRLPEAAGPEACALP
Download sequence
Identical sequences ENSDNOP00000013802 XP_004456315.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]