SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014238 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014238
Domain Number 1 Region: 720-860,892-969
Classification Level Classification E-value
Superfamily RNI-like 3.14e-31
Family 28-residue LRR 0.0025
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 4.12e-19
Family Pyrin domain, PYD 0.000095
Further Details:      
 
Domain Number 3 Region: 1378-1459
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000647
Family Caspase recruitment domain, CARD 0.018
Further Details:      
 
Domain Number 4 Region: 326-417,451-498
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000419
Family G proteins 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014238   Gene: ENSDNOG00000018344   Transcript: ENSDNOT00000018344
Sequence length 1479
Comment pep:known_by_projection scaffold:Dasnov3.0:JH582755.1:497987:541570:1 gene:ENSDNOG00000018344 transcript:ENSDNOT00000018344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGIKLRLAWYLELLSKEEMAEFQLQLPSKALHEGSSGVTPAETGTANGMEVASRLVAQ
YGEQQAWDLALHTWQQMGLDRLYTQARAEANLGSHTALLTSPSAPGLESPSWPTSTEVLS
LWGSKYLCSQDSDPKAPKAGCSWQVFPIDCSSWLGHISSSPSHTSPNQQSPTAPMSTAVL
GGWVPPPQPSPDPREQAASQAKGLLTEGSHKYVVQSRKRMTGFSRESTGLSLPPWSRTEH
QNVQKVTSGSQMGHLHHLEISPNERSQKSQSWKKEDFHQKFTELILLHRTGPQVQEFLFT
GSWPQEAKEQGHLIEVQDLFGPGLGTQEGPRTVLLMGAAGIGKSTLARQVRRAWEDGQLY
RDRFQHVFYLNCRELAQTKVVSLAELMADQAAPLAPIGQILSQPTQLLLILDGFDEPGWI
FKKHRSELCFLWSQQQPVHILLSSLLRKTLLPEASLLITAQTTSLLELLFFVEQLHWVEV
LGFSEAGRKEYFYNYFTDDSQATRAFSLVESNQALLTMCLVPWVSRLVCTCLKQQMERGE
ELPLTSQTTTALCLHYLSQAFPAQPLRAQLKSLCSLAAKSTEQGKALFSLCYLKKQGFSK
AVISTFVKMGVFQKPTFLSFSFAHSGLQEFFAAIFYALGDEERSHYPKSTHDVRKLLRVC
GRQVVFGTLTTRFLFGLAGEHGARELENIFNLKPSGELRGELLRWVETELRCGGFSKQPY
RLELLLCLYEIQDEEFLTQVMAYFQEARVWIQTDVDLLVFTFCLQFCRNVKRLQLSGQHG
PAWRAHSVVLCMEVPITDARWQILFSILGVAGSLRELDLSGNSLSHSAVQGLCKALRHPQ
CHLETLRLDCGLGSRDVKGVRIQIRVGERGDEWDHKYSFFQDFDNKEEVDRVSGQEPCKL
HGVRLVGCGLTSSCCADLASALGASPSLRELDLQQNDLDAAGVGLLCEGLRHPACPLKLL
QLGQIPWSDKVSQELRALEEEKPQLLVTSRWKQSVAMAKEDPDWGETSSETSSLKRQRLG
KGPSAAHRRGLGETGQESLELTTALPAAEEHSPQATLAEPRWLAGPSLPEDLLTEPLATE
DDFQGPTGLVATQVVDEEKGQYRVHFPMAGTYRWPSTRLCFVVRWAVTLEIEFCAWSQFL
DGTSLQHGWMVAGPLFDIKAEPGAVAAVHLPHFVNLEEGNVDISLFQVAHIKEEGTLLEK
PARVEPEHAVLESPSFSPMGVLLRVIHAALRIPITSIVLLYHRRHPEEVVFHLYLVPSDC
SIRKAIDDEEKMSQFVQLRKPPPLTPLYMGSRYVVSGSENLEMIPKELELCYRSPGQPQL
FSEFYVGHLGSGIRLQVKDKKCGTMVWEALVKPGDLRTAVTPLPPSPKASPPLPYAPALH
FVDRHREQLVARVTSVEPILDKLHGWVLSEEQYERVRAEATTLDQMRKLFSFSRSWNLAC
KDRLYQALEEIHPHLTVELRKCDSHRDQEGLLTNSAAEV
Download sequence
Identical sequences ENSDNOP00000014238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]