SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014629 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014629
Domain Number 1 Region: 1005-1258
Classification Level Classification E-value
Superfamily SET domain 1.01e-82
Family Histone lysine methyltransferases 0.0000395
Further Details:      
 
Domain Number 2 Region: 741-984
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.18e-70
Family Ankyrin repeat 0.0000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014629   Gene: ENSDNOG00000018846   Transcript: ENSDNOT00000018848
Sequence length 1297
Comment pep:known_by_projection scaffold:Dasnov3.0:JH573481.1:40969:192522:-1 gene:ENSDNOG00000018846 transcript:ENSDNOT00000018848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALRDLEAVPTKGETKKDCCMKTELLTEEVSMAADEGSAEKHGGEGHVAADGETNGSCEK
SDASTHPNAAKHTQENTKVSPQEGKLTRIAENGISERDTEAGKQNHVKGDDFTQTSVLGS
NGYFLNKPPLQEQPVRTTSALTSSLPGHAAKTLPGGAGKGRTPGSFSQMQATVPAKPGEG
SQDAEGKKPTPPGPDVKVHRARKTMPKSTLGLHAASKDPREAREARDHKESKEEINKNIS
DFGRQQLLSPFPSLHQSLPQNQCYVATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKK
KTKVLKQRTVIEMFKSITHSTVGSKGEKDLGDSAVHVNGESLEVDSEEEESDELDEEEDH
GVEPVAAFPTEDSRTSKESMSETDRTQKKVCARTREERERECEQLEGRRESDRSSESSIK
KKFLKRKGKTDSPWIKPTRKRRRRNKKKPVGLLSSDACKSSGSTEQTAPGDRVGYVEVSL
DSLDLRVKGILSPQAEGLANGPTRGETDGLQEVPLCSCRMETPKSREMTTLAHSQCMATE
STDHELGRCTHGVVKHELMRPSNKVPLLVLCEDHRGRMAEHQCCPGCGCFCTACLWRPRE
CGKSGGLSYQMHTCCAIPAHGDTSAPRCAQQTALLLRVQLFQAGTGHSTLSPSPSILEPG
ICLHGRSCSMPLSGAGPQLSEEEKPRTPTPQPPEGFDLTGPSGFVKPSPGLPQGPGKETL
ESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQGKRAPLHAA
AEAGHVDICHMLIQAGANIDTCSEDQRTPLMEAAENNHLDAVKYLIKAGALADPKDAEGS
TCLHLAAKKGHYDVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVELVKLLLSKGSDIN
IRDNEENICLHWAAFSGCVDIAEILLAARCDLHAVNIHGDSPLHIAARENRYDCVVLFLS
RDSDVTLKNKEGETPLQCARLNSQVWAALQMSRALRDAAPDRPAPVERTVSRDIARGYER
IPIPCVNAVDSEPCPGNYKYVPQNCVTSPMNIDRNITHLQYCVCVDDCSSSNCMCGQLSV
RCWYGQDGRLLPEFNMAEPPLIFECNHACSCWRSCRNRVVQNGLRARLQLYRTRSMGWGV
RSLQDIPLGTFVCEYVGELVSDSEADVREEDSYLFDLDNKDGDMYCIDARFYGNVSRFIN
HHCEPNLVPVRVFMSHQDLRFPRIAFFSTRAIEAGEPLGFDYGDRFWDIKGKLFRCQCGS
PKCRHSSTAVAQRQASVGQGREDGLPDTSSSATADPL
Download sequence
Identical sequences ENSDNOP00000014629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]