SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000014662 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000014662
Domain Number 1 Region: 41-508
Classification Level Classification E-value
Superfamily Sema domain 6.93e-132
Family Sema domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 1353-1480,1676-1865
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.33e-51
Family p120GAP domain-like 0.022
Further Details:      
 
Domain Number 3 Region: 859-953
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000303
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 4 Region: 953-1040
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000373
Family Other IPT/TIG domains 0.055
Further Details:      
 
Domain Number 5 Region: 1038-1142
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000245
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 511-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000654
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 1139-1228
Classification Level Classification E-value
Superfamily E set domains 0.0000021
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 8 Region: 810-843
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000432
Family Plexin repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000014662
Domain Number - Region: 655-687
Classification Level Classification E-value
Superfamily Plexin repeat 0.0379
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000014662   Gene: ENSDNOG00000018886   Transcript: ENSDNOT00000018888
Sequence length 1895
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569928.1:1627314:2000148:-1 gene:ENSDNOG00000018886 transcript:ENSDNOT00000018888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEMKTMPWNWTCLLSHLLMVGMGSSTLLPRPPPPLSPKRSFVTFRGESAEGFNHLVVDER
TGHIYLGAVNRIYKLSSDLKVLVTHQTGPDEDNPKCYPPRIVQTCNEPLTPTNNVNKMLL
IDYKENRLIACGSLYQGICKLLRLEDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYNNL
DDKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTVIPD
FDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDSAFNSYVEVPIG
CERNGVEYRLLQAAYLSKAGAMLARTLGVRPDDDLLFTVFSKGQKRKMKSLDESALCIFI
LKQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSEMV
RGIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPG
PVLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYRSCGECLGSGDPHCGWCVLHNTCTRK
ERCERSREPRRFASEMKQCVQLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLS
EMDGLVVGNQIQCYSPAAKEVPQIIMENGDHHVVQLQLKSKETGMTFASTNFVFYNCSVH
NSCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKP
ITLKAKNLPQPQSGQRGYECILSIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPV
ELTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFECGWCQGQGQCTLRQHCP
THESQWLELSGTNSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGV
ECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDL
KPSRGPMSGGTQVTITGTNLNAGSHVVVMFGKQPCLFHRRSSFHIICNTTSSDEVLELQV
MVQVDKAKIHQDLFFQYMEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGG
KEHINLCEVLNATEMTCQAPALTLGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYY
PNPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCSVTVSDVQL
LCESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIA
YKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRT
YTMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLEAQRSFS
MRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLT
NWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKT
LVLSCVNPDNVNSPEIPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGS
GARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSAS
KYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLT
RLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWK
SNCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLL
YAKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGK
YSEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences ENSDNOP00000014662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]