SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017151 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017151
Domain Number 1 Region: 43-139
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.19e-30
Family Hormone receptor domain 0.00000468
Further Details:      
 
Domain Number 2 Region: 120-405
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000751
Family Rhodopsin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017151   Gene: ENSDNOG00000024411   Transcript: ENSDNOT00000024986
Sequence length 436
Comment pep:known_by_projection scaffold:Dasnov3.0:JH565077.1:274764:315018:-1 gene:ENSDNOG00000024411 transcript:ENSDNOT00000024986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPVGALCLPCVPHLLFCLLCLLPPLLKAAGPSQVPKAPSPRALLEHCCGAGTTLASLS
GSYSYCNTTLDQIGTCWPRSVAGALVERPCPEYFNGVKYNTTRNAYRVCLENGTWASRIN
YSQCEPILDDKQRNYDLHYHIALIVNYLGHCISVATLVAAFLLFLTLRSIRCLRNVIHWN
LITTFILRNVMWFLLQLIDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIA
MTYSTERLRKWLFLFIGWGIPCPIIIAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIIL
VLLINFIFLFNIVRILMTKLRASTTSEMIQYRKAVKATLVLLPLLGTTYMLFFVNPGEDD
LSQIVFIYFNSFLQSFQATKQGPIRKDFKEEVRSAVRKRWHRWQDHHSLQVPVRAMSIPT
SPTRVSFHSIKQTAAV
Download sequence
Identical sequences ENSDNOP00000017151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]