SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000017316 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000017316
Domain Number 1 Region: 930-1078
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-39
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 2 Region: 635-778
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-37
Family C-type lectin domain 0.000000423
Further Details:      
 
Domain Number 3 Region: 788-922
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-37
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 4 Region: 1217-1355
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-34
Family C-type lectin domain 0.00022
Further Details:      
 
Domain Number 5 Region: 16-147
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.12e-33
Family Cysteine rich domain 0.00000165
Further Details:      
 
Domain Number 6 Region: 1086-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 1.44e-32
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 7 Region: 496-635
Classification Level Classification E-value
Superfamily C-type lectin-like 4.81e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 224-339
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-26
Family C-type lectin domain 0.00075
Further Details:      
 
Domain Number 9 Region: 344-484
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-22
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 10 Region: 147-205
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000017316   Gene: ENSDNOG00000023592   Transcript: ENSDNOT00000025393
Sequence length 1451
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569316.1:258581:360039:1 gene:ENSDNOG00000023592 transcript:ENSDNOT00000025393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARAPRACSFLSVCADARQFLMYNDDHKRCVEAVGPTAVQTAACDRDSEAQRFRWVSPTQI
MSVAFKLCLGVPSKTDWVPVTLYACDAKSELQRWECRNDTLLGLKGEDLFFNYGNRQEKN
VMLYKGAGLWSRWKVFGSSSDLCSRGYEAMYTLLGNANGATCAFPFKFEGKWYADCTSAG
RSDGWLWCGTTADYDADKLFGFCPLKFEGSESLWNRDPLTSISYQINSKSALTWHQARKS
CQQAAELLSVTEIHEQTYLTGLTSSLTSGLWIGLNSLSFSTGWQWSSGSPFRYLNWLPGS
PSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVLPSESDVPSACPSQWW
PYAGHCYKIHREKKIQRDAVTACRKEGGDLASLHSVEEFDFVLSQLGYEPGDELWIGLLH
PLAHLPGPAWPAAPPGTPAWPPLGLHGERGNERQDDFSASLASGEDGYWADRTCEQPLDY
VCKTRSQARAPADAPVDAGCRKNWKRHGFYCYSIGHTLSTFTEANQTCRNEKAYLTTVED
RYYEQAFLTSLVGLRPERYFWTGLSDVRARGTFAWTTEEAVQFTHWNADMPGRKTGCVAM
RTGIAGGLWDVLKCDEKAKFVCKHWAEGVTRPPEPTTTPEPRCPEDWGTDSKTSLCFKLF
AKGKHDKKTWFESRDFCRALGGDLASINNKDEQQVIWRLVTATANYHERFWLGLTYGSPS
EGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGEPGLSWNDMNCENLNNWICQIRKGQ
TPKPEPTPAAQDNPAITEDGWVIYKDYQYYFSKEKETMDNAREFCKRNFGDLVSIRSESE
KKFLWKYVNRNDAQTAYFIGLLISLDRKFAWMDGSKVDFVAWATGEPNFANDDENCVTMY
SNSGFWNDINCGYPNAFICQRHNSSINATAPPTAPPAPGGCKEGWDFHNNKCFKIFGFVE
EERKNWQDARKACIAFGGNLVSIPSNKEQGFLTYHMKDSTFNAWIGLNDVNSEHTFLWTD
GRGVHYTNWGKGYPGGRRSSLSYEDADCVVILGGKSREGGKWMDDTCDSKRGYICQTQSD
PSLHYSPTIIPPDGFIKYGESSYSFVKFKLPWHEAKSYCEYNGSQIASILDPYNDAFVWM
HMLASKEPMWIALNSNETNNEYAWTDGWRVRYTNWAADEPRLKSACVYLDLDGSWKTASC
SESFYFVCKRSAEIPATEPPQLPGRCPESEHTAWIPFHGHCYYIESSYTRNWGQASLECL
RMSSSLVSIESAAESSFLSYRVEPLKSKTDFWIGLYRNVQGNWLWINNNPLSFVNWNTGE
PSGERNDCVFLSAASGFWRVIHCSSYKGYICKRPKIIDAEPTQTSVTTKADLRKMDPEKP
SPRVAGVAVVVIFLLAGAGLTAYFFYKRRRAQLPRAENFENTLYFNSQSSSGMGDTRELV
GNIEQNEHAVI
Download sequence
Identical sequences ENSDNOP00000017316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]