SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000018787 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000018787
Domain Number 1 Region: 27-65,297-379
Classification Level Classification E-value
Superfamily SET domain 2.94e-27
Family Viral histone H3 Lysine 27 Methyltransferase 0.091
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000018787
Domain Number - Region: 108-137
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000575
Family MYND zinc finger 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000018787   Gene: ENSDNOG00000043321   Transcript: ENSDNOT00000039599
Sequence length 417
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569412.1:199263:209671:-1 gene:ENSDNOG00000043321 transcript:ENSDNOT00000039599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASMCDVFSFCVGVAGPARVAVEVRFVSSAKGKGLFATHLIRKGETIFVERPLVAAQFL
WNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPHPELCTVRKDLHQNCPHCQVMYCS
AECRLAAAEQYHQVLCPGPSQEDPLHPLNKLQEAWRSVHYPPETASIMLMARMVATVKQA
KDKERWIRLFSQFCNKTANEEEEIVHKLLGDKFKGQLELLRRLFTEALYEEALSQWFTPD
GFRSLFALVGTNGQGIGTSSLSQWVHACDALELKPQDRERLDAFIDQLYKDIEAATGEFL
NCEGSGLFMLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEICISYLDCCQRERS
RHSRHKILRENYLFVCSCPKCLAEADEPNVTSEEEEEEEEEEGEAEDAELGDEMTDV
Download sequence
Identical sequences ENSDNOP00000018787 XP_004465536.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]