SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000019529 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000019529
Domain Number 1 Region: 130-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000231
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 174-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 76-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000404
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000019529
Domain Number - Region: 481-775
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00494
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000019529   Gene: ENSDNOG00000040621   Transcript: ENSDNOT00000048182
Sequence length 806
Comment pep:novel scaffold:Dasnov3.0:JH571227.1:302815:338193:1 gene:ENSDNOG00000040621 transcript:ENSDNOT00000048182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLARLCAWRRGSRRLLPGLSVLLLLSLGAAAQKPTAPCAPWCSQHSTCVSATACRCHP
GFTSLSGEISSSFEEPCEDINECVPPMTVSCGKMASCKNVEGSYECECSAGYMLPSGGKT
FRNESENRCQDVNECTSERTPCHSSAHCLNKVGGYQCRCRPGWKPAPGSPHGPNTTVCED
EDECSSGKHRCHESTYCVNTIGAYVCRCRRGWVPKPGCLNNQNTTVCTESSIPPWAPPPG
ISSQTLSGFFDKVQTLLRDFKPTTAQSTIKGLIQDVGDLLETPGDLESLPRSEQHCVAAH
LLAGLEDVLRGMSKALPNGPLNASAPAGTELSLLVQEGGGDNVTLKLAKAQLLLDPDVAQ
EPGDSGPSVVGLVSTPGKLLAEAALVREPGKQPLHEPLQVWPQARPPILLSSVISAFLGH
KVTKNLSSPVTFNFAHDGTPRPGQEVVCAFWEHSQDGCGHWATTGCQMLGTTDGSTTCRC
THLSSFAILMAQGDMQDEDPVLAVITYVGLGLSLLCLFLAALTFVLCKAIQNTSTSLHLQ
LSICLFLAHLLFLTGIDRIEPKVLCAIIAGTLHYLYLAAFAWMLLEGLHLFLMARNLTVL
NYSSVSRFMKKSMFPVGYGVPAVVVTISAASRPHLYGTPKRCWLHTDNGFIWAFLGPVCA
IFSINLAFFLMTFWIVKTKLFSLNSEVSTLQNTRMLAFKATAQLFILGCTWCLGMLQVGP
AAHVMLYLFTIVNSLQGVFIFLVYCLLSQQVREQYRNWFKGIQGMKTESEKHTVTSRIIP
HASKPSTENYDQLNQMSLSPRKGRKS
Download sequence
Identical sequences ENSDNOP00000019529 XP_004472552.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]