SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000020141 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000020141
Domain Number 1 Region: 332-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000809
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 2 Region: 262-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000628
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 3 Region: 395-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000020141
Domain Number - Region: 101-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0289
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000020141   Gene: ENSDNOG00000000488   Transcript: ENSDNOT00000037785
Sequence length 540
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564257.1:345884:458070:-1 gene:ENSDNOG00000000488 transcript:ENSDNOT00000037785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCARLLLLWGCSAVAAGLTGVVRVHSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCVYSENTDLTCRQPKCDKCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIMVFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAM
CTSRYSNPFPCTGGEVIFRALLPPYDAENPYSAKIQEQLKITNLRVQLLKRQPCPCQRND
LNVKPQHFTHYAIYDFIVKGSCFCNGHADQCVPVDGFRPVKAPGAFHVVHGKCLCKHNTA
GTHCQHCAPLYNDRPWEAADGKTGAPKECRTCKCNGHADVCHFDLNVWEASGNRSGGVCK
DCQHNTEGQHCQRCKPGFYRDLQRPFSAPDACKVCSCHPTGSAALPFSSVTFCDPSNGDC
PCKPGVAGPHCDRCMVGYWGFGDYGCRPCDCAGSCDPFTGDCISSTDIDWIHEIPDFHSM
HNNSKPTWEWEDEQGFSALRHSGKCECKEQVLGNSKAFCGMKYSYGKFKSPSMILRTYSN
Download sequence
Identical sequences ENSDNOP00000020141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]